DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3491 and sbno2

Sequence 1:NP_609731.1 Gene:CG3491 FlyBaseID:FBgn0028887 Length:1801 Species:Drosophila melanogaster
Sequence 2:XP_017952368.1 Gene:sbno2 XenbaseID:XB-GENE-486292 Length:1339 Species:Xenopus tropicalis

Alignment Length:1308 Identity:561/1309 (43%)
Similarity:755/1309 (58%) Gaps:202/1309 (15%)


  Fly   559 QPAIPPQPAIPPA----------PAYCMANKTMDTGMSSVVQMANNPLASTQHHALPQVPIVTRL 613
            ||:.|......||          ||:|:.:.::   .|......|.|..|.....|         
 Frog    35 QPSQPDSETATPAGNLWTHNTYSPAHCLPHASL---TSPSQPFLNYPAHSNFFQDL--------- 87

  Fly   614 KVDQGEDVSVKFTTGLDGL---------ITNVQLLPSTMAMGQPTVKATELESF-TAQQLNML-- 666
                   .|.:|::...||         :||.....|.::....::.....:.| |.:.|:.:  
 Frog    88 -------ASQRFSSSFSGLSYCDFQEPSLTNDFSNQSILSSSPDSLSDINTQDFLTIEGLDRVPT 145

  Fly   667 --------LQSGHPYLSLPMTNSGVPGAVLQETLQ------TKDAGFPSEQAVEDEEVDYEEIGV 717
                    ....:|:|..|  |..:|.....|.||      :.....|.|:..|||  |.||:|.
 Frog   146 LWDISTPPQDFSNPHLFHP--NPPLPALETFEDLQAIINTPSTQERLPPEEEEEDE--DTEELGH 206

  Fly   718 ADTFAAYWPSKLKFGRAHPDPVVETATLSSVELPNINYQLALPSKTTE--CLSALQLEAVVYACQ 780
            .:|:|.|.|||.|.||.|||.||||:|||||..|:|.|.|:|||...|  .|||||||::|||||
 Frog   207 TETYADYVPSKSKIGRQHPDRVVETSTLSSVPPPDITYSLSLPSDVIEQGLLSALQLESIVYACQ 271

  Fly   781 AHEQILPSGDRAGFLLGDGAGVGKGRTIAGIIFDNYLKGRKRALWVSVSSDLKFDAERDLADIGA 845
            .||.|||||.|||||:|||||||||||::|||.:|:.||||:|||.|||:||:.||||||.||.|
 Frog   272 QHEVILPSGQRAGFLIGDGAGVGKGRTVSGIILENFSKGRKKALWFSVSNDLRCDAERDLRDINA 336

  Fly   846 HEKIRVATINKFKYSPIDSEENENFKRGVIFCTYTALIGESMTTNSKYKTRFRQLTNWLGKKFEG 910
            .. |.|..:||.||....|.|      ||:|.||:||||||. ...:::||.:|:.:|.|:||:|
 Frog   337 GH-IAVHALNKIKYGDTSSSE------GVLFATYSALIGESQ-AGGQHRTRIKQIRDWCGEKFDG 393

  Fly   911 VIVFDECHKAKNLSLMNVGKSTKTGTTVLDLQKLLPNARVVYASATGASEPRNMAYMVRLGLWGP 975
            ||||||||||||.|      |||.|..||:||..||.||||||||||||||:||.||.|||:||.
 Frog   394 VIVFDECHKAKNAS------STKMGRAVLELQNNLPMARVVYASATGASEPKNMIYMSRLGIWGE 452

  Fly   976 GTAYPEFYEFVNAVEKRGIGAMEIVAMDMKLRGTYIARQLSFKDVSFRIEEVNMSKEFRKSYNLS 1040
            ||::..|.:|::|:||||:|||||||||||:.|.||||||||..|:|||||:.:.:.::..||.:
 Frog   453 GTSFSTFDDFLHAIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVTFRIEEIPLEESYKHMYNRA 517

  Fly  1041 AELWADIHKKFQKACRLMCVENRVQKIITCQFWCAHQRFFKNLCIASKVNHVVKMTRQATRMGKA 1105
            |:|||:....||.|...:.:|:|  |.:..|||.|||||||.|||||||..:|.:.:|....||.
 Frog   518 AQLWAEALVVFQTAADWLGLESR--KSLWGQFWSAHQRFFKYLCIASKVQRLVTLVKQELAKGKC 580

  Fly  1106 VVIGLQSTGESRTLEHLERHHGKLNSFVSTAKMIIQSFVEKHFPAPKRDSFHHLLNTGEFEPEAR 1170
            ||||||||||:||.|.::.:.|.|:.|||.|:.:.:|.:.||||:.||..        |...:.|
 Frog   581 VVIGLQSTGEARTREVMDENDGHLDCFVSAAEGVFRSLILKHFPSTKRKR--------EKAMQKR 637

  Fly  1171 SRPPKQKKSKMNTDWV-------EDDMDAEAG-ESDI----EMYERSCTAAVEKIKSGQKRRGRP 1223
            .|..|.:..||:...:       |...|:|.| :||.    |.::......:|:..:|.....|.
 Frog   638 KRRGKPRSGKMSRGDLGLIRISEESSSDSEGGLDSDFNSSPESFQDDDVIYIERTMNGMTLPDRV 702

  Fly  1224 PKADKVEKITMQERILEHLCNNMREQDNEDESTNTSDNTKVKVNITERDVERCINMREMLLEKID 1288
            |:.|:                                                  ::..||.|::
 Frog   703 PEVDR--------------------------------------------------LKMELLAKVE 717

  Fly  1289 VLGRKLPPNTLDKLISELGGTNLVAEMTGRRGRVVRTEYDGYKYEPRCENDSTMDLVNYREKQRF 1353
            .||::||.||||:||.:.||...|||||||:|||||......::|.|.|.:.::|.||.|||:||
 Frog   718 TLGKELPLNTLDELIDQFGGPEKVAEMTGRKGRVVRKSDRTVQFESRAEQNLSIDNVNLREKERF 782

  Fly  1354 MDGSKHVAIISEAASSGISLQSDKRVSNQRRRLHITLELPWSADRAIQQFGRTHRSNQVNAPEYV 1418
            |:|.|.|||||||:|||||||:||||.|:|||:|:||||||||||||||||||||||||:|||||
 Frog   783 MNGEKLVAIISEASSSGISLQADKRVPNKRRRVHMTLELPWSADRAIQQFGRTHRSNQVSAPEYV 847

  Fly  1419 FVITDLAGERRFASTVAKRLESLGALTQGDRRATDARDLSQFNIDNSIGRSALENVMQQLTSNKP 1483
            |:|::||||:||||.||||||||||||.||||||::||||::|.:|..|..|||.::..:     
 Frog   848 FLISELAGEKRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENKYGTRALEQILSAI----- 907

  Fly  1484 LDRSQ----VPQSYKGN---FIYDCCVAMAGVGMINVREENKVKVFTVEKDSNNISKFLNRILGC 1541
            |:::|    .|:.|.|:   |..:....:..|| |..||   .|...::|:. :::|||||:||.
 Frog   908 LNQTQREVPPPRDYPGSSKEFFQEIKQGLLSVG-ICCRE---TKHNAIDKEC-SVTKFLNRMLGL 967

  Fly  1542 RVEVQNALFKFFLDKMYSLIMQMKRTGRFDLGILDLDAHGASVKSIKLMRFIRKHATGTAATELH 1606
            .|..||:||:||.|....||.:.|:.|::|:||||| |.|...        |.:.:..|..|..|
 Frog   968 EVHKQNSLFQFFSDTFDYLIEKDKKEGKYDMGILDL-APGVDE--------IYQESKETFMTPGH 1023

  Fly  1607 ---------TVTVERGMSFETALAKYR--KEGQYEHEGFYILQKRRQNKNSAILCLQAPSNSSDV 1660
                     |::|:||||:..||.||:  |:   :|||||:..:.|....||:|        ::.
 Frog  1024 PQDGQVVFYTISVDRGMSWAKALEKYQNLKD---QHEGFYLSYRARGTMFSAVL--------AEH 1077

  Fly  1661 SNGKINLQIYRPNTGPQVRLETHASISSRYVKVSPEEAQTYWVQQYELCLNMCSH-LYWNRTCP- 1723
            .:||. ..:|:||.|.|.:.|...|:.|:|.|||||||..:|..||...|:.||| :..|..|. 
 Frog  1078 RHGKY-FNLYKPNIGRQSQAEALDSLLSKYHKVSPEEAMEHWEDQYNFSLHNCSHTMCRNGNCKG 1141

  Fly  1724 MPTG--CEVGLRMRTYHVLSGLMLPIWDRIELII--VNSGHKIQIIRMKTDANKKIVGTVVPPAV 1784
            :..|  |..|||:|.|::|.|.:|.:|.|:..:|  :.|...:||:|:||....|.||..:|.:.
 Frog  1142 LQQGKKCVQGLRLRYYYMLCGSLLRVWSRMASVISDITSSSYLQIVRLKTKDKHKQVGIKIPESC 1206

  Fly  1785 YDDLVADL 1792
            .|.:..:|
 Frog  1207 VDKVKEEL 1214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3491NP_609731.1 AAA_34 737..1038 CDD:290583 187/303 (62%)
DEXDc 759..986 CDD:214692 141/229 (62%)
Helicase_C_4 1297..1576 CDD:290582 160/286 (56%)
sbno2XP_017952368.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2397079
eggNOG 1 0.900 E1_KOG1513
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D112455at33208
OrthoFinder 1 1.000 FOG0005700
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.