DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3491 and sbno2a

Sequence 1:NP_609731.1 Gene:CG3491 FlyBaseID:FBgn0028887 Length:1801 Species:Drosophila melanogaster
Sequence 2:NP_001232891.1 Gene:sbno2a ZFINID:ZDB-GENE-100629-3 Length:1350 Species:Danio rerio

Alignment Length:1320 Identity:555/1321 (42%)
Similarity:750/1321 (57%) Gaps:160/1321 (12%)


  Fly   516 VAVPADENIEPLGKT--DQHFSVPTNKNLS--ENKAFPKPNQVCIPPQPA----IPPQPA--IPP 570
            |.:..::.:.|.|..  ...||.|:....|  |::.: :||......|..    .|.|..  :.|
Zfish     8 VVMDTEDYLHPEGPQLGSPKFSAPSPPLTSSMESQLY-QPNSWAYSQQAQYNQHYPMQSGRQLQP 71

  Fly   571 APAYCMANKTMDTGMSSVVQMANNPLASTQHHAL-------PQVPIVTRLKVDQGEDVSVKFTTG 628
            .|::                 .|..|:....|.|       .::|..        ::|:..|::.
Zfish    72 TPSF-----------------MNLDLSDIDFHELVRNGDFSQELPCT--------DEVASLFSSP 111

  Fly   629 LDGLITNVQLLPSTMAMGQPTVKATELESFTAQQLNMLLQSGHPYLSLPMTNSGVPGAV--LQET 691
            .|.|:.    .|.....|..::.....|...||....:  .||.  ..|:..|..||.:  |...
Zfish   112 SDSLLE----YPEPSGFGTDSLAQLTGEGPAAQMYWDI--PGHS--QRPLNLSAFPGRLDELNAI 168

  Fly   692 LQTKDAGF--------PSEQAVEDEEVDYEEIGVADTFAAYWPSKLKFGRAHPDPVVETATLSSV 748
            |....|||        |.|:..|.::.:.||:|.|||:|.|.|||...|.:|||.||||.|||||
Zfish   169 LSPSVAGFKAAAAPAPPPEEEEEADDEETEELGHADTYAEYKPSKSTIGISHPDIVVETNTLSSV 233

  Fly   749 ELPNINYQLALPSKT--TECLSALQLEAVVYACQAHEQILPSGDRAGFLLGDGAGVGKGRTIAGI 811
            ..|:|.|.|::|..|  |..||||||||::||||.||.||.:..|||||:|||||||||||:.||
Zfish   234 PPPDITYTLSIPDSTVSTGLLSALQLEAIIYACQQHEVILQNSQRAGFLIGDGAGVGKGRTVIGI 298

  Fly   812 IFDNYLKGRKRALWVSVSSDLKFDAERDLADIGAHEKIRVATINKFKYSPIDSEENENFKRGVIF 876
            |.:|:|||||||||.|.|:|||:||||||.||.| ..|.|..:||.||....:.|      ||:|
Zfish   299 ILENFLKGRKRALWFSASNDLKYDAERDLKDIDA-PNIPVFALNKIKYGDTATSE------GVLF 356

  Fly   877 CTYTALIGESMTTNSKYKTRFRQLTNWLGKKFEGVIVFDECHKAKNLSLMNVGKSTKTGTTVLDL 941
            .||:||||||. ...:::||.:|:.:|....|:|||||||||||||.:      |||.|..||||
Zfish   357 ATYSALIGESQ-AGGQHRTRLKQILDWCKPSFDGVIVFDECHKAKNAT------STKMGKAVLDL 414

  Fly   942 QKLLPNARVVYASATGASEPRNMAYMVRLGLWGPGTAYPEFYEFVNAVEKRGIGAMEIVAMDMKL 1006
            |..||.||||||||||||||:||.||.|||:||.||.:..|.:|::|:||||:|||||||||||:
Zfish   415 QSKLPRARVVYASATGASEPKNMIYMSRLGIWGQGTPFKTFDDFLHAIEKRGVGAMEIVAMDMKV 479

  Fly  1007 RGTYIARQLSFKDVSFRIEEVNMSKEFRKSYNLSAELWADIHKKFQKACRLMCVENRVQKIITCQ 1071
            .|.||||||||..|||||||:.:.:||:..||.:|.|||:..:.|.:|...:.:.:|  |.:..|
Zfish   480 SGMYIARQLSFSGVSFRIEEIALDEEFKLVYNKAARLWAEALELFNRAADTLGLASR--KSLWGQ 542

  Fly  1072 FWCAHQRFFKNLCIASKVNHVVKMTRQATRMGKAVVIGLQSTGESRTLEHLERHHGKLNSFVSTA 1136
            ||.:||||||.||||:||..:|.:.....:.||.:|||||||||:||.|.|:.:.|.|:.|:|.|
Zfish   543 FWSSHQRFFKYLCIAAKVRRLVDLAHMEMQQGKCIVIGLQSTGEARTREVLDENDGHLDKFISAA 607

  Fly  1137 KMIIQSFVEKHFPA--PKRDSFHHLLNTGEFEPEAR-SRPPKQKKSKMNTDWVEDDMDAEAGESD 1198
            :.:.||.|:||||.  |||:.  ...|..:.:|..| |:.|||:........:.||.|:::.|.|
Zfish   608 ERVFQSLVQKHFPTQKPKREK--SAANKRKRKPRGRPSKFPKQRVEVGGVIKISDDSDSDSDEFD 670

  Fly  1199 IEMYERSCTAAVEKIKSGQKRRGRPPKADKVEKITMQERILEHLCNNMREQDNEDESTNTSDNTK 1263
            .|     ..::.|.:                                   |||:|         .
Zfish   671 SE-----SNSSPESL-----------------------------------QDNDD---------V 686

  Fly  1264 VKVNITERDVERCINMREMLLEKIDVLGRKLPPNTLDKLISELGGTNLVAEMTGRRGRVVRTEYD 1328
            :.||.......:...:::.||.:|..||::||.||||:||...||...|:|||||:|||||....
Zfish   687 IFVNHINGPAAKLEELKQRLLHRIAELGKELPLNTLDELIDRFGGPEKVSEMTGRKGRVVRRPDG 751

  Fly  1329 GYKYEPRCENDSTMDLVNYREKQRFMDGSKHVAIISEAASSGISLQSDKRVSNQRRRLHITLELP 1393
            ..:||.|.|...|:|.||.|||:|||.|.|.:||||||||||||||:||||.|:|||:|:|||||
Zfish   752 SVRYESRAEQGLTIDHVNVREKERFMSGEKLIAIISEAASSGISLQADKRVQNRRRRVHMTLELP 816

  Fly  1394 WSADRAIQQFGRTHRSNQVNAPEYVFVITDLAGERRFASTVAKRLESLGALTQGDRRATDARDLS 1458
            |||||||||||||||||||.||||:|:|::|||||||||.||||||||||||.||||||::||||
Zfish   817 WSADRAIQQFGRTHRSNQVTAPEYIFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLS 881

  Fly  1459 QFNIDNSIGRSALENVMQQLTSNKPLD-RSQVPQSYKGN---FIYDCCVAMAGVGMINVREENKV 1519
            |:|.:|..|..||:.:.:.:..:  :| :...|:.|.|.   |..|....|..||:.  .:|.::
Zfish   882 QYNFENKYGTKALDKITKAILGH--IDNKVPPPKGYPGGGLMFFRDMKKGMIDVGIF--CKEPRM 942

  Fly  1520 KVFTVEKDSNNISKFLNRILGCRVEVQNALFKFFLDKMYSLIMQMKRTGRFDLGILDLDAHGASV 1584
            .:.| |||. .::||||||||..|..||.||::|.:....||.:.|:.|::|:|||||......:
Zfish   943 GLNT-EKDC-TLTKFLNRILGLEVHHQNFLFQYFTENFDYLIEKDKKEGKYDMGILDLAPGNDEI 1005

  Fly  1585 KSIKLMRFIRKHATGTAATELHTVTVERGMSFETALAKYRK-EGQYEHEGFYILQKRRQNKNSAI 1648
            ......:|:...........|:.::|:|||.::.|.:|..| .|.|  ||||:..|.|.::...:
Zfish  1006 HEETQEKFLTPGNPQEGQVILYKISVDRGMPWKEACSKAEKLTGDY--EGFYLSNKLRGSQPCVL 1068

  Fly  1649 LCLQAPSNSSDVSNGKINLQIYRPNTGPQVRLETHASISSRYVKVSPEEAQTYWVQQYELCLNMC 1713
            |..|        ..|: ||.:|:||.|.|...|...::..||.||.||:|:..|..|::.....|
Zfish  1069 LAEQ--------GRGR-NLILYKPNIGKQAHPENLDNLLLRYYKVLPEDAKDVWESQFDFSFTNC 1124

  Fly  1714 SHLYWNRTC-PMPTG--CEVGLRMRTYHVLSGLMLPIWDRIELII--VNSGHKIQIIRMKTDANK 1773
            ||..|...| .:..|  |.:|:|:|.||:|.|.:|.:|.|:..|:  :.:...:||:|:||..|.
Zfish  1125 SHANWKGKCKQIEEGQECFLGMRLRQYHMLCGALLRVWKRVSDIVSDITNSSILQIVRLKTKQNS 1189

  Fly  1774 KIVGTVVPPAVYDDLVADLS 1793
            |.||..:|......:.|:||
Zfish  1190 KQVGIKIPENCVSRVRAELS 1209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3491NP_609731.1 AAA_34 737..1038 CDD:290583 185/303 (61%)
DEXDc 759..986 CDD:214692 136/229 (59%)
Helicase_C_4 1297..1576 CDD:290582 161/283 (57%)
sbno2aNP_001232891.1 AAA_34 222..512 CDD:290583 186/304 (61%)
Helicase_C_4 720..997 CDD:290582 161/283 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2389245
eggNOG 1 0.900 E1_KOG1513
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D112455at33208
OrthoFinder 1 1.000 FOG0005700
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129178
Panther 1 1.100 O PTHR12706
Phylome 1 0.910 0.687 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.