DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3491 and sbno1

Sequence 1:NP_609731.1 Gene:CG3491 FlyBaseID:FBgn0028887 Length:1801 Species:Drosophila melanogaster
Sequence 2:XP_017945924.1 Gene:sbno1 XenbaseID:XB-GENE-479411 Length:1410 Species:Xenopus tropicalis

Alignment Length:1421 Identity:632/1422 (44%)
Similarity:848/1422 (60%) Gaps:179/1422 (13%)


  Fly   499 ESDIDARLQAELDSLPM-VAVPADENIEPLGKTDQHFSVPTNKNLSENKAFPKPNQVCIPPQPAI 562
            ||.|.|....:.|||.: :..|.     ||....|..|:..:....||:|      ..:..:|..
 Frog    15 ESGISANDLFDGDSLDIGLIAPT-----PLPAIQQAVSISGSGISKENEA------SVLKQEPLA 68

  Fly   563 PPQPAI----PPAPAYCMANK--TMDTGMSSVVQMANNPLASTQHHALPQVPIVTRLKVDQGEDV 621
            ....|:    ||:....:.|:  .:.|..:::|...|.|:.:|:     |...||::        
 Frog    69 TSASALLNVRPPSTTTFVLNQINQLPTLGNTIVMTKNTPVTTTR-----QTITVTKI-------- 120

  Fly   622 SVKFTTGLDGLITNVQLLPSTMAMGQPTVKAT--ELESFTAQQLNMLLQSG--HPYLSL-PMTNS 681
                      |.||....|||.|   |.|:.|  .:.|....||..||::.  :..:.| |.:|.
 Frog   121 ----------LQTNSTTRPSTAA---PVVQTTVAAVPSKDQIQLKDLLKTSSLNKLMKLKPPSNI 172

  Fly   682 GVPGAVLQETL--------QTKDAGFPS--------------------------------EQAVE 706
            ..|.|...:.|        .||.|..|:                                ::..|
 Frog   173 AQPVATAAKFLILSPKVVCPTKSADLPNGAKKDISKEVTRIWINEDIKMRSFSPTNKVPVKEDEE 237

  Fly   707 DEEVDYEEIGVADTFAAYWPSKLKFGRAHPDPVVETATLSSVELPNINYQLALPSKTTE--CLSA 769
            .||.|.:|:|.|:|:|.|.|.|||.|..||||||||::||||..|::.:|..:|.:|.:  .|||
 Frog   238 PEEEDEDEMGHAETYAEYMPIKLKVGLRHPDPVVETSSLSSVTPPDVWFQTTIPEETIDNGWLSA 302

  Fly   770 LQLEAVVYACQAHEQILPSGDRAGFLLGDGAGVGKGRTIAGIIFDNYLKGRKRALWVSVSSDLKF 834
            ||||||.||.|.||..||:|:|||||:|||||||||||||||||:|||..|||:||.|||:|||:
 Frog   303 LQLEAVTYAAQQHETFLPNGERAGFLIGDGAGVGKGRTIAGIIFENYLLSRKRSLWFSVSNDLKY 367

  Fly   835 DAERDLADIGAHEKIRVATINKFKYSPIDSEENENFKRGVIFCTYTALIGESMTTNSKYKTRFRQ 899
            ||||||.|||| :.|:|.::|||||..|.|:.|.:.|:||||.||::|||||. :..|||||.:|
 Frog   368 DAERDLRDIGA-KNIQVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ-SGGKYKTRLKQ 430

  Fly   900 LTNWLGKKFEGVIVFDECHKAKNLSLMNVGKSTKTGTTVLDLQKLLPNARVVYASATGASEPRNM 964
            |.:|.|:.|:||||||||||||||..:...|.||||..||:||..||.|||||||||||||||||
 Frog   431 LLHWCGEDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNM 495

  Fly   965 AYMVRLGLWGPGTAYPEFYEFVNAVEKRGIGAMEIVAMDMKLRGTYIARQLSFKDVSFRIEEVNM 1029
            |||.|||:||.||.:.||.:|:.|||:||:||||||||||||||.||||||||..|:|:||||.:
 Frog   496 AYMSRLGIWGEGTPFREFNDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVPL 560

  Fly  1030 SKEFRKSYNLSAELWADIHKKFQKACRLMCVENRVQKIITCQFWCAHQRFFKNLCIASKVNHVVK 1094
            ..::.|.||.|.:||....::||:|..|:..|.|::|.:..|||.|||||||.|||||||..||:
 Frog   561 GHDYVKMYNKSVKLWVLARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVRRVVQ 625

  Fly  1095 MTRQATRMGKAVVIGLQSTGESRTLEHLERHHGKLNSFVSTAKMIIQSFVEKHFPAPKRDSFHHL 1159
            :.|:..:.||.||||||||||:||||.||...|:||.|||||:.::||.:|||||||.|.....|
 Frog   626 LAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTARGVLQSLIEKHFPAPDRKKLFSL 690

  Fly  1160 L----------NTGEFEPEARSRPPKQK------------KSKMNTDWVEDDMDAEAGESDIEMY 1202
            |          |:....|...|:..|:|            ||........|||.:|:..|:.:..
 Frog   691 LGIDLSAQSNNNSPRDSPSKDSKVKKRKGEELLREAKKPRKSGGLAGSSSDDMGSESDTSEKDAG 755

  Fly  1203 ERSCTAAVEKIKSG---------------------------QKRRGRPPKADKVEKITMQERILE 1240
            ..|  .:.:.:.||                           :|.:.:..|...::..::|..:|.
 Frog   756 SES--ESFKSVSSGDDDDFNPFRDESSEDEEDDPWLIRKDHKKNKHKKKKKKSIDPDSIQSALLA 818

  Fly  1241 HLCNNMREQDNE-------DESTNTS-----DNTKVKVN-ITERD-VERCINMREMLLEKIDVLG 1291
            ....:.|...:.       ..:|.||     :||.|..: :|.:| |||...|::.||:|::.|.
 Frog   819 SGLGSKRPSFSSVVKAAATSTTTTTSVPAPLNNTNVSNSCVTSQDAVERAQQMKKELLDKLENLA 883

  Fly  1292 RKLPPNTLDKLISELGGTNLVAEMTGRRGRVVRTEYDGYKYEPRCENDSTMDLVNYREKQRFMDG 1356
            ..|||||||:||.||||.:.|||||||:||||..:.....||.|.|.|..::::|..||||||||
 Frog   884 EALPPNTLDELIDELGGPDNVAEMTGRKGRVVSNDDGSISYESRSELDVPVEILNITEKQRFMDG 948

  Fly  1357 SKHVAIISEAASSGISLQSDKRVSNQRRRLHITLELPWSADRAIQQFGRTHRSNQVNAPEYVFVI 1421
            .|::||||||||||||||:|:|..|||||:|:||||||||||||||||||||||||.||||||:|
 Frog   949 EKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLI 1013

  Fly  1422 TDLAGERRFASTVAKRLESLGALTQGDRRATDARDLSQFNIDNSIGRSALENVMQQLTSNKPLDR 1486
            ::||||:||||.||||||||||||.||||||::||||:||.||..||:|||.||:.:.|   ||.
 Frog  1014 SELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVS---LDS 1075

  Fly  1487 SQV--PQSYKGNFIYDCCVAMAGVGMINVREENKVKVFTVEKDSNNISKFLNRILGCRVEVQNAL 1549
            ..|  |..:.|:|..|....:.|||:|||  |::..:.|::||.|||.||||||||..|..||||
 Frog  1076 PLVSPPPEFPGDFFKDVRQGLIGVGLINV--EDRSGILTLDKDYNNIGKFLNRILGMEVHQQNAL 1138

  Fly  1550 FKFFLDKMYSLIMQMKRTGRFDLGILDLDAHGASVKSIKLMRFIRKHATGTAATELHTVTVERGM 1614
            |::|.|.:.::|...|:.||:|:|||||.:....|:.....:|:....:.:...||:|::|||||
 Frog  1139 FQYFSDTLSAVIQNAKKNGRYDMGILDLGSGDEKVRKSDAKKFLTPGYSTSGHVELYTISVERGM 1203

  Fly  1615 SFETALAKYRKEGQYEHEGFYILQKRRQNKNSAILCLQAPSNSSDVSNGKINLQIYRPNTGPQVR 1679
            |:|.| .|...|.....:|||:..:.|.||.:.||.       .:::..|....:||||||.|::
 Frog  1204 SWEDA-TKIWAEQTGPDDGFYLSLQIRNNKKTGILV-------KEINPKKKLFLVYRPNTGKQLK 1260

  Fly  1680 LETHASISSRYVKVSPEEAQTYWVQQYELCLNMCSHLYWNRTC---PMPTGCEVGLRMRTYHVLS 1741
            |||...:..:|.||:.|:||::|.:||....::|:|.||...|   .:...||:|||.|||:||.
 Frog  1261 LETLLDLKKKYKKVTSEDAQSHWKEQYISSADICTHAYWRGNCKKASLGLVCEIGLRCRTYYVLC 1325

  Fly  1742 GLMLPIWDRIELIIVN-SGH--KIQIIRMKTDANKKIVGTVVPPAVYDDLVADLST 1794
            |.:|.:|.::|.::.: ||.  |:||:|::|:..::|||.::|......||..|||
 Frog  1326 GSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLIIPANCVSSLVTLLST 1381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3491NP_609731.1 AAA_34 737..1038 CDD:290583 199/303 (66%)
DEXDc 759..986 CDD:214692 152/229 (66%)
Helicase_C_4 1297..1576 CDD:290582 175/281 (62%)
sbno1XP_017945924.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D112455at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.