DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3491 and sbno1

DIOPT Version :8

Sequence 1:NP_609731.1 Gene:CG3491 / 34870 FlyBaseID:FBgn0028887 Length:1801 Species:Drosophila melanogaster
Sequence 2:NP_001186845.1 Gene:sbno1 / 100005813 ZFINID:ZDB-GENE-080522-2 Length:1386 Species:Danio rerio

Alignment Length:1414 Identity:619/1415 (44%)
Similarity:827/1415 (58%) Gaps:200/1415 (14%)


  Fly   501 DIDARLQAELDSLPMVA--VPADENIEPLGKTDQHFSVPTNKNLSENKAFPKPNQVCIPPQPAIP 563
            |:|.:     ||:|:|:  .|...|...:|.:::...|                         :.
Zfish    24 DVDVQ-----DSVPLVSSQQPVSLNALDIGLSNEASGV-------------------------VR 58

  Fly   564 PQPAIPPAPAYCMANKTMDTGMSSVVQMANNPLASTQHHALPQVPIVTRLKVDQGEDVSVKFTTG 628
            ..|.:||.|...:..|...:..:.|:...|.         ||.:..:...|...|.......|  
Zfish    59 IDPPVPPTPTVTIREKPQPSTTTFVLNQLNQ---------LPSLGTIVVSKPSTGSSTRQTIT-- 112

  Fly   629 LDGLITNV--QLLPSTMAMGQPTVKATELESFTAQ-QLNMLLQS--------GHPYLSLPMTNSG 682
                :|.|  ...|:..:...|:| .|...:.|.| :|..||:|        |......|..:..
Zfish   113 ----VTKVLHSSSPAQRSSASPSV-CTAAPANTEQIRLKDLLRSSSLKSSSLGELMKLKPPADIA 172

  Fly   683 VPGAV----------LQETLQTKDA---------------------GFPSEQAVEDEEVDYEEIG 716
            .|.|.          |::.:.:||.                     |...|:  |.||.:.||:|
Zfish   173 PPVATATGTTEVNNGLKKEVSSKDVARIWINDDMKMRSFSPVNKLPGMKEEE--EPEEEEEEELG 235

  Fly   717 VADTFAAYWPSKLKFGRAHPDPVVETATLSSVELPNINYQLALPSKTTE--CLSALQLEAVVYAC 779
            .|:|:|.|.|.|.:.|..||||||||::||||..|::.|:|::|.:|.:  .|||||||||.||.
Zfish   236 HAETYAEYMPMKQRIGLRHPDPVVETSSLSSVNPPDVWYRLSIPEETIDRGWLSALQLEAVTYAA 300

  Fly   780 QAHEQILPSGDRAGFLLGDGAGVGKGRTIAGIIFDNYLKGRKRALWVSVSSDLKFDAERDLADIG 844
            |.||..||:||||.:|:||||||||||||||||::|||.||||:||.|||:|||:||||||.|||
Zfish   301 QQHETFLPNGDRAAYLIGDGAGVGKGRTIAGIIYENYLLGRKRSLWFSVSNDLKYDAERDLRDIG 365

  Fly   845 AHEKIRVATINKFKYSPIDSEENENFKRGVIFCTYTALIGESMTTNSKYKTRFRQLTNWLGKKFE 909
            | :.|:|.::|||||..|.|:.|.:.|:||||.||::|||||. :..||||||:||.:|.|..|:
Zfish   366 A-KNIQVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ-SGGKYKTRFKQLLHWCGDDFD 428

  Fly   910 GVIVFDECHKAKNLSLMNVGKSTKTGTTVLDLQKLLPNARVVYASATGASEPRNMAYMVRLGLWG 974
            |||||||||||||:..:...|.||||..||:||..||.||||||||||||||||||||.|||:||
Zfish   429 GVIVFDECHKAKNVCPIGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWG 493

  Fly   975 PGTAYPEFYEFVNAVEKRGIGAMEIVAMDMKLRGTYIARQLSFKDVSFRIEEVNMSKEFRKSYNL 1039
            .||.:.||..|:.|||:||:||||||||||||||.||||||||..|:|:||||.::.::.|.||.
Zfish   494 EGTPFREFANFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVPLTLDYIKMYNK 558

  Fly  1040 SAELWADIHKKFQKACRLMCVENRVQKIITCQFWCAHQRFFKNLCIASKVNHVVKMTRQATRMGK 1104
            :..||....:|||:|.:||..|.|::|.:..|||.|||||||.|||||||..||::.|:..:.||
Zfish   559 AVRLWVSAREKFQQAAQLMDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVRRVVQLAREDVKNGK 623

  Fly  1105 AVVIGLQSTGESRTLEHLERHHGKLNSFVSTAKMIIQSFVEKHFPAPKRDSFHHLL--------- 1160
            .||||||||||:||||.||...|:||.||||||.::||.||||||||.|.....||         
Zfish   624 CVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLVEKHFPAPDRQKLLSLLGIDLSAKKT 688

  Fly  1161 -----NTGEFE------PEARSRPPKQKKSKMNTDWVEDDMDAEAGESDIEMYERSCTAAVEKIK 1214
                 |..|.:      ||::....|.:||...:....||..:|..:.|.|..:     :.:.|.
Zfish   689 PSPAENKTEQKGKKRKVPESKKHVKKARKSGGLSGSSSDDSSSEDSDRDAESDD-----SFKSIS 748

  Fly  1215 SGQKRRGRPPKAD-----------------------------KVEKITMQERILEHLCNNMR--- 1247
            ||.:....|.|.|                             .::..::|..:|.......|   
Zfish   749 SGDEDDFNPFKDDSSEDEEDDPWLIRKDSKKSKDKRNKKKKKSIDPDSIQSALLASGLGTTRPTF 813

  Fly  1248 --------------EQDNEDESTNTSDNTKVKVNITERDVERCINMREMLLEKIDVLGRKLPPNT 1298
                          :.|.|:.|..||.:.          ||....|:..||||:::|...|||||
Zfish   814 TAPIKPANPTLAVAKSDPEESSCVTSQDA----------VEDAQRMKRDLLEKLELLAEDLPPNT 868

  Fly  1299 LDKLISELGGTNLVAEMTGRRGRVVRTEYDGYKYEPRCENDSTMDLVNYREKQRFMDGSKHVAII 1363
            ||:||.||||.:.|||||||:||||..:.....||.|.|.|..::::|..|||.||||.|::|||
Zfish   869 LDQLIDELGGPDNVAEMTGRKGRVVSNDDGSISYESRSELDVPVEILNLTEKQTFMDGDKNIAII 933

  Fly  1364 SEAASSGISLQSDKRVSNQRRRLHITLELPWSADRAIQQFGRTHRSNQVNAPEYVFVITDLAGER 1428
            |||||||||||:|:||.|||||:|:||||||||||||||||||||||||.||||||:|::||||:
Zfish   934 SEAASSGISLQADRRVKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQ 998

  Fly  1429 RFASTVAKRLESLGALTQGDRRATDARDLSQFNIDNSIGRSALENVMQQLTSNKPLDRSQV--PQ 1491
            ||||.||:|||||||||.||||||:.||||:||.||..||:|||.||:.:.|   ||...|  |.
Zfish   999 RFASIVAQRLESLGALTHGDRRATETRDLSRFNFDNKYGRNALEIVMKSIVS---LDSPLVSPPA 1060

  Fly  1492 SYKGNFIYDCCVAMAGVGMINVREENKVKVFTVEKDSNNISKFLNRILGCRVEVQNALFKFFLDK 1556
            .:.|:|..:....:.|||:|||  |::..|.:::||.|||.||||||||..|:.|||||::|.|.
Zfish  1061 DFDGDFFKEIRNGLIGVGLINV--EDRSGVLSLDKDYNNIGKFLNRILGMEVQQQNALFQYFSDT 1123

  Fly  1557 MYSLIMQMKRTGRFDLGILDLDAHGASVKSIKLMRFIRKHATGTAATELHTVTVERGMSFETALA 1621
            :.::|...|::||:|:|||||.:....||.:.:.:|:....:.:...||:||:||||||:|.|..
Zfish  1124 LSAVIQNAKKSGRYDMGILDLGSGDEKVKKVDVKKFLTPGYSTSGHVELYTVSVERGMSWEEATH 1188

  Fly  1622 KYRKEGQYEHEGFYILQKRRQNKNSAILCLQAPSNSSDVSNGKINLQIYRPNTGPQVRLETHASI 1686
            .:..:...: :|||:  :.|.||..|||.       .:|:..|....:||||.|.|.:|||:..|
Zfish  1189 VWADQNGPD-DGFYV--QVRNNKKIAILV-------KEVNPRKRLFMVYRPNIGKQAKLETYTDI 1243

  Fly  1687 SSRYVKVSPEEAQTYWVQQYELCLNMCSHLYWNRTCPMPT---GCEVGLRMRTYHVLSGLMLPIW 1748
            ..|..||..::|:.:|:.||....::|||.||...|...:   .||:|||.|||.||.|.:|.:|
Zfish  1244 KKRSKKVLSDDAKQHWMDQYSCSADVCSHAYWRGNCKKASVGLQCEIGLRCRTYFVLCGSVLSVW 1308

  Fly  1749 DRIELIIVN-SGH--KIQIIRMKTDANKKIVGTVVPPAVYDDLVADLST 1794
            .::|.::.: ||.  |:||:|::|:..::|||.::|......||..||:
Zfish  1309 TKVEGVLASVSGANVKMQIVRLRTEDGQRIVGLIIPQNCVSPLVNILSS 1357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3491NP_609731.1 AAA_34 737..1038 CDD:290583 199/303 (66%)
DEXDc 759..986 CDD:214692 151/229 (66%)
Helicase_C_4 1297..1576 CDD:290582 173/281 (62%)
sbno1NP_001186845.1 AAA_34 256..558 CDD:290583 200/304 (66%)
Helicase_C_4 867..1143 CDD:290582 173/281 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D112455at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12706
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.