DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3491 and si:ch73-63e15.2

Sequence 1:NP_609731.1 Gene:CG3491 FlyBaseID:FBgn0028887 Length:1801 Species:Drosophila melanogaster
Sequence 2:XP_001342116.5 Gene:si:ch73-63e15.2 ZFINID:ZDB-GENE-091204-463 Length:1452 Species:Danio rerio

Alignment Length:1285 Identity:553/1286 (43%)
Similarity:744/1286 (58%) Gaps:168/1286 (13%)


  Fly   564 PQPAIPPA-PAYCMANK----------TMDTGMSSVVQMANNPLASTQHHALPQVPIVTRLKVDQ 617
            |..:|||| ..:..:|.          .:.|.||.|  .|||      |.:.|..|....... |
Zfish     2 PSLSIPPAMDGHSFSNSVGPQLDARGFVLATPMSHV--FANN------HWSFPNQPFGLPCPA-Q 57

  Fly   618 GEDVSVKFTTGLDGLITNVQLLP--------STMAMGQPTVKATELESFTAQQLNMLLQSGHPYL 674
            .|:....| .|:..:.|:  |||        |.:.:.|......:...|:.|..::...:...:|
Zfish    58 SENQQSCF-NGVSDMHTD--LLPQDLSNFDFSGLDLPQDLSCLDDQLIFSPQNDSLSEYASTNFL 119

  Fly   675 SLPMTNSGVP-------GAVLQET------LQTKD-----------AGF--PSEQAVEDEEVDY- 712
            :..|..: ||       .|.:||:      |.:.|           .|:  |..|..|:||||. 
Zfish   120 NADMAPT-VPTIWDIKTPAPVQESSNRFQGLNSLDDISAIINTPPIGGYQRPQTQPEEEEEVDVE 183

  Fly   713 --EEIGVADTFAAYWPSKLKFGRAHPDPVVETATLSSVELPNINYQLALPSKTTE--CLSALQLE 773
              ||:|..||:|.|.|||.|.|.:|||.||||.|||||..|:|.|.|::|..|.:  .|||||||
Zfish   184 EAEELGHVDTYADYKPSKSKIGISHPDRVVETNTLSSVPPPDITYTLSIPEDTIKDGLLSALQLE 248

  Fly   774 AVVYACQAHEQILPSGDRAGFLLGDGAGVGKGRTIAGIIFDNYLKGRKRALWVSVSSDLKFDAER 838
            |:.||||.||.||.:..|||||:|||||||||||:||||.:|.|||||:|||.|||:|||:||||
Zfish   249 AITYACQQHEVILQNSQRAGFLIGDGAGVGKGRTVAGIILENNLKGRKKALWFSVSNDLKYDAER 313

  Fly   839 DLADIGAHEKIRVATINKFKYSPIDSEENENFKRGVIFCTYTALIGESMTTNSKYKTRFRQLTNW 903
            ||.|||| ..|||..:||.||....:.|      ||:|.||:||||||. ...:::||.:|:.:|
Zfish   314 DLQDIGA-VSIRVHALNKIKYGDTATSE------GVLFVTYSALIGESQ-AGGQHRTRLKQILDW 370

  Fly   904 LGKKFEGVIVFDECHKAKNLSLMNVGKSTKTGTTVLDLQKLLPNARVVYASATGASEPRNMAYMV 968
            ...:|:|||:|||||||||.:      |||.|..|||||..||.||||||||||||||:||.||.
Zfish   371 CEPEFDGVIIFDECHKAKNAT------STKMGKAVLDLQNKLPLARVVYASATGASEPKNMIYMS 429

  Fly   969 RLGLWGPGTAYPEFYEFVNAVEKRGIGAMEIVAMDMKLRGTYIARQLSFKDVSFRIEEVNMSKEF 1033
            |||:||.||.:..|.:|::.:||||:|||||||||||:.|.||||||||..|||||||:::..:|
Zfish   430 RLGIWGEGTPFRTFDDFLHTIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVSFRIEEISLDNDF 494

  Fly  1034 RKSYNLSAELWADIHKKFQKACRLMCVENRVQKIITCQFWCAHQRFFKNLCIASKVNHVVKMTRQ 1098
            :..||.:|:|||:..:.|.:|...:|:.:|  |.:..|||.:||||||.||||:||..:|::.::
Zfish   495 KLVYNKAAKLWAEALRVFMQAADELCMSSR--KSLWGQFWSSHQRFFKYLCIAAKVRCLVELAKK 557

  Fly  1099 ATRMGKAVVIGLQSTGESRTLEHLERHHGKLNSFVSTAKMIIQSFVEKHFPAPKRDSFHHLLNTG 1163
            ....||.||||||||||:||.|.|:.:.|.|:.|||.|:.:.||.|.||||:.|:.......|..
Zfish   558 ELEAGKCVVIGLQSTGEARTREVLDENDGHLDRFVSAAEGVFQSLVFKHFPSEKQMREKGAGNKR 622

  Fly  1164 EFEPEAR-SRPPKQKKSKMNTDW----VEDDMDAEAGESDIEMYERSCTAAVEKIKSGQKRRGRP 1223
            :.:|.|| |:.|:|     .||.    :.||...|:     ::.:....::.:.|          
Zfish   623 KRKPRARQSKQPRQ-----GTDIAVINISDDSSTES-----DVMDSDSNSSPDSI---------- 667

  Fly  1224 PKADKVEKITMQERILEHLCNNMREQDNEDESTNTSDNTKVKVNITERDVERCINMREMLLEKID 1288
                                     |||.|:        .:.|:.|.....|..:|::.||.||.
Zfish   668 -------------------------QDNNDD--------VIFVDQTSYQKARLEDMKQGLLNKIA 699

  Fly  1289 VLGRKLPPNTLDKLISELGGTNLVAEMTGRRGRVVRTEYDGYKYEPRCENDSTMDLVNYREKQRF 1353
            .||::||.||||:||.:.||...|:|||||:|||||......:||.|.|...|:|.:|.:||.||
Zfish   700 ELGKELPLNTLDELIDKFGGPEKVSEMTGRKGRVVRRPDGSVQYESRAEQGHTIDQINIKEKDRF 764

  Fly  1354 MDGSKHVAIISEAASSGISLQSDKRVSNQRRRLHITLELPWSADRAIQQFGRTHRSNQVNAPEYV 1418
            |:|.|.|||||||||||||||:|:||.||.||:|:|||||||||||||||||||||||||||||:
Zfish   765 MNGEKLVAIISEAASSGISLQADRRVKNQCRRVHMTLELPWSADRAIQQFGRTHRSNQVNAPEYI 829

  Fly  1419 FVITDLAGERRFASTVAKRLESLGALTQGDRRATDARDLSQFNIDNSIGRSALE----NVMQQLT 1479
            |:|::|||||||||.||||||||||||.||||||::||||::|.:|..|..||:    .::.|..
Zfish   830 FLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENKYGTKALDKITKTILGQTE 894

  Fly  1480 SNKPLDRSQVPQSYKGN---FIYDCCVAMAGVGMINVREENKVKVFTVEKDSNNISKFLNRILGC 1541
            |..|     .|:.|.|.   |..|....|..|||:  ..::::.: .:|||. ||:||||||||.
Zfish   895 SKVP-----PPKDYPGGEAMFFRDMKYGMMDVGML--CSQSRLGI-NIEKDC-NITKFLNRILGL 950

  Fly  1542 RVEVQNALFKFFLDKMYSLIMQMKRTGRFDLGILDLDAHGASVKSIKLMRFIRKHATGTAATELH 1606
            .|..||:||::|.|....||...|:.|.:|||||||......:......:|:...........|:
Zfish   951 EVHKQNSLFQYFTDNFDYLIEMDKKVGNYDLGILDLAPGNDQIYEETQEKFLTAGNPQDGQVVLY 1015

  Fly  1607 TVTVERGMSFETALAKYRKEGQYEHEGFYILQKRRQNKNSAILCLQAPSNSSDVSNGKINLQIYR 1671
            .::|:|||.:..||.|:....:.: ||||:..:.|.|....:|.:|....         |:.:|:
Zfish  1016 KISVDRGMPWSEALEKFETLTKPD-EGFYMSYRLRSNHPCVLLAVQGKER---------NMILYK 1070

  Fly  1672 PNTGPQVRLETHASISSRYVKVSPEEAQTYWVQQYELCLNMCSHL-YWNRTCPMPTG--CEVGLR 1733
            ||.|.|::.|:...:..:|.||:|.:.|..|..|:...|..|||. .:.|...:..|  |.:|.|
Zfish  1071 PNIGKQLQPESIDKLQQKYRKVTPADVQDSWENQFNFSLRKCSHANQYGRCKRIDDGQECTMGTR 1135

  Fly  1734 MRTYHVLSGLMLPIWDRIELII--VNSGHKIQIIRMKTDANKKIVGTVVP 1781
            :|.||:|.|.:|.:|.|:..|:  :.|...:||:|:||..:.|.||..:|
Zfish  1136 LRQYHMLCGALLRVWKRVSDIVADITSSSILQIVRLKTKDSNKQVGIKIP 1185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3491NP_609731.1 AAA_34 737..1038 CDD:290583 184/303 (61%)
DEXDc 759..986 CDD:214692 137/229 (60%)
Helicase_C_4 1297..1576 CDD:290582 164/286 (57%)
si:ch73-63e15.2XP_001342116.5 AAA_34 210..500 CDD:290583 185/304 (61%)
Helicase_C_4 708..985 CDD:290582 164/286 (57%)
Bud13 1198..>1245 CDD:286779
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2389196
eggNOG 1 0.900 E1_KOG1513
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1057 1.000 Inparanoid score I236
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D112455at33208
OrthoFinder 1 1.000 FOG0005700
OrthoInspector 1 1.000 T597196
orthoMCL 1 0.900 OOG5_129178
Panther 1 1.100 O PTHR12706
Phylome 1 0.910 0.687 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.