DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ProtA and ProtB

DIOPT Version :10

Sequence 1:NP_477050.1 Gene:ProtA / 34866 FlyBaseID:FBgn0013300 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_477051.1 Gene:ProtB / 34867 FlyBaseID:FBgn0013301 Length:144 Species:Drosophila melanogaster


Alignment Length:144 Identity:133/144 - (92%)
Similarity:138/144 - (95%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSNNVNECKSLWNGIISISAKDESPKGLTEMCNHPIRRAPQKCKPMKSCAKPRRKAACAKATRP 65
            ||||||||||||||||||||||||||||||||||||.||||.|||||||||||||||||||||||
  Fly     1 MSSNNVNECKSLWNGIISISAKDESPKGLTEMCNHPKRRAPPKCKPMKSCAKPRRKAACAKATRP 65

  Fly    66 KVKCAPRQKCSKQGPVTNNAYLNFVRSFRKKHCNLKPRELIAKAAKAWARLSENRKDRYRRMACK 130
            ||||||.|||||||||||||||||||.||||||:|||:||||:||||||.|.|:|||||||||||
  Fly    66 KVKCAPSQKCSKQGPVTNNAYLNFVRFFRKKHCDLKPQELIAEAAKAWAELPEHRKDRYRRMACK 130

  Fly   131 VTTSERHKRRRICQ 144
            |||||||||||||:
  Fly   131 VTTSERHKRRRICK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ProtANP_477050.1 Protamine_like 60..146 CDD:283927 76/85 (89%)
ProtBNP_477051.1 Protamine_like 60..>144 CDD:283927 75/83 (90%)

Return to query results.
Submit another query.