DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ProtA and ProtB

Sequence 1:NP_001285945.1 Gene:ProtA FlyBaseID:FBgn0013300 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_477051.1 Gene:ProtB FlyBaseID:FBgn0013301 Length:144 Species:Drosophila melanogaster

Alignment Length:144 Identity:133/145 (92%)
Similarity:138/145 (95%) Gaps:0/145 (0%)


  Fly     1 MSSNNVNECKSLWNGIISISAKDESPKGLTEMCNHPIRRAPQKCKPMKSCAKPRRKAACAKATRP 65
            ||||||||||||||||||||||||||||||||||||.||||.|||||||||||||||||||||||
  Fly     1 MSSNNVNECKSLWNGIISISAKDESPKGLTEMCNHPKRRAPPKCKPMKSCAKPRRKAACAKATRP 65

  Fly    66 KVKCAPRQKCSKQGPVTNNAYLNFVRSFRKKHCNLKPRELIAKAAKAWARLSENRKDRYRRMACK 130
            ||||||.|||||||||||||||||||.||||||:|||:||||:||||||.|.|:|||||||||||
  Fly    66 KVKCAPSQKCSKQGPVTNNAYLNFVRFFRKKHCDLKPQELIAEAAKAWAELPEHRKDRYRRMACK 130

  Fly   131 VTTSERHKRRRICQ 144
            |||||||||||||:
  Fly   131 VTTSERHKRRRICK 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ProtANP_001285945.1 DUF1074 60..146 CDD:283927 76/86 (88%)
ProtBNP_477051.1 DUF1074 60..>144 CDD:283927 76/84 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140828577
eggNOG 1 0.900 E1_2C8XZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.