DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ProtA and CG15278

Sequence 1:NP_001285945.1 Gene:ProtA FlyBaseID:FBgn0013300 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001246032.1 Gene:CG15278 FlyBaseID:FBgn0032554 Length:164 Species:Drosophila melanogaster

Alignment Length:37 Identity:10/38 (26%)
Similarity:16/38 (42%) Gaps:5/38 (13%)


  Fly     9 CKSLWNGIISISAKDESPKGLTEMCNHPIRRAPQKCK 45
            |:.||     :.....|.:.||.||..|:.:....|:
  Fly   113 CQLLW-----VHGHAHSLRLLTIMCLGPVCQVVLVCR 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ProtANP_001285945.1 DUF1074 60..146 CDD:283927
CG15278NP_001246032.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C8XZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.