DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN1a and gps1

DIOPT Version :8

Sequence 1:NP_609720.1 Gene:CSN1a / 34857 FlyBaseID:FBgn0028838 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_012821921.1 Gene:gps1 / 493337 XenbaseID:XB-GENE-955148 Length:560 Species:Xenopus tropicalis

Alignment Length:348 Identity:138/349 (40%)
Similarity:213/349 (61%) Gaps:21/349 (6%)


  Fly     5 EETMLHLPSYADRYTDIPRLIRLKFIAQVCPELSVLALELALNHVKTTYNVKLYDELYKTLCVEV 69
            |...|.|..||..|:.:.|:.||:|||..||:|.|.||::||:.|:.|:||.:|:::::.| .|.
 Frog   111 ENPTLDLEQYASSYSGLMRIERLQFIADRCPQLRVEALKMALSFVQRTFNVDVYEDIHRKL-TEA 174

  Fly    70 DRKYPNQSKGNEELHTTGGSEPSTSSGRGRVVVPYDSYWVEDNIMEATLMLQELDAELNFKKSNS 134
            .|:..|......|    |..||.          |.|:.|||....:|.|.|::||.:|...|.||
 Frog   175 SREVQNAPDAVPE----GSMEPP----------PLDTTWVEATRKKALLKLEKLDTDLKNYKGNS 225

  Fly   135 GSSYVRRILEEIGDHHEKSGNLQMAVKFYARARPYCTSSENVINMFRNLIRVSIYMENWWHVLTY 199
            ....:||..:::|||:...|:|..|:|.|:|||.||||:::||||..|:|:||:|::||.|||:|
 Frog   226 IKESIRRGHDDLGDHYLDCGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSY 290

  Fly   200 IDEAK------QYAYGFENLAQEVPARLSCVAGLAHLGLKIYKSAAQYFLSTPYGRYDYDKIVAP 258
            :.:|:      :.....::..|.|..:|.|.||||.|..:.||.||:.||...:...|:.::::|
 Frog   291 VSKAESTPEIAEQRGERDSQTQSVLTKLKCAAGLAELAARKYKQAAKCFLLASFDHCDFPELLSP 355

  Fly   259 EDVTLYAGLCALATFDRETLQLNAINSEAFKPFFQLSPKMWTILAKFYAGEFDACMTLLREIENH 323
            .:|.:|.||||||||||:.||.|.|:|.:||.|.:|.|::..|:.|||..::.:|:.:|.|::::
 Frog   356 SNVAVYGGLCALATFDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDN 420

  Fly   324 VRLDVYLSPHVSALYDLIMARML 346
            :.||:||:|||..||..|..|.|
 Frog   421 LLLDMYLAPHVRTLYTQIRNRAL 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSN1aNP_609720.1 RPN7 105..281 CDD:287560 77/182 (42%)
gps1XP_012821921.1 RPN7 196..378 CDD:287560 77/182 (42%)
PCI 393..497 CDD:279707 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0686
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D223526at33208
OrthoFinder 1 1.000 FOG0003750
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.780

Return to query results.
Submit another query.