DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN1a and CSN1b

DIOPT Version :8

Sequence 1:NP_609720.1 Gene:CSN1a / 34857 FlyBaseID:FBgn0028838 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_524152.2 Gene:CSN1b / 40063 FlyBaseID:FBgn0027057 Length:525 Species:Drosophila melanogaster

Alignment Length:378 Identity:143/379 (38%)
Similarity:225/379 (59%) Gaps:36/379 (9%)


  Fly     2 DNGEETM-------LHLPSYADRYTDIPRLIRLKFIAQVCPELSVLALELALNHVKTTYNVKLYD 59
            :|.||..       :.|..||::|..|.||.||.::|.|||.|:|.||::|:.:|:|||||.||.
  Fly    29 ENNEEQQIVVENPSIDLEVYANQYAGIVRLHRLIYVADVCPVLAVEALKMAITYVQTTYNVNLYQ 93

  Fly    60 ELYKTL--CVEVDRKYPNQSKGNEELHTTGGSEP----------------STSSGRGRVVV---- 102
            .|:|.|  ....:...|..:.|.::   .|.:.|                :.:.|:.:..|    
  Fly    94 VLHKRLSDLNAGNAPAPPANAGGDQ---AGAAAPGPLAAAPLPDIAAQPVAQAQGQAQPAVEKDA 155

  Fly   103 -PYDSYWVEDNIMEATLMLQELDAELNFKKSNSGSSYVRRILEEIGDHHEKSGNLQMAVKFYARA 166
             .||:.||:..:.:|.|.|::||::|...||||....:||..:::.||:...|:|..|:|.|:||
  Fly   156 FAYDAAWVDTKMKKAALKLEKLDSDLKNYKSNSIKESIRRGHDDLADHYLSCGDLTNALKCYSRA 220

  Fly   167 RPYCTSSENVINMFRNLIRVSIYMENWWHVLTYIDEAK---QYAYGFENLAQEVPARLSCVAGLA 228
            |.||||.::|:||..|:|:||||::||.||::||.:|:   .:|.|.:....:|..||.|.||||
  Fly   221 RDYCTSGKHVVNMCLNVIKVSIYLQNWAHVMSYISKAESTPDFAEGSKEANAQVHTRLECAAGLA 285

  Fly   229 HLGLKIYKSAAQYFLSTPYGRYDYDKIVAPEDVTLYAGLCALATFDRETLQLNAINSEAFKPFFQ 293
            .|..|.||.||::||:..:...|:.::::..:|.:|.||||||||||:.|:...|.|.:||.|.:
  Fly   286 ELQQKKYKVAAKHFLNANFDHCDFPEMISTSNVAVYGGLCALATFDRQELKRLVIASTSFKLFLE 350

  Fly   294 LSPKMWTILAKFYAGEFDACMTLLREIENHVRLDVYLSPHVSALYDLIMARML 346
            |.|::..|:.|||..::.:|:|||.||.:::.:|:|::|||:.||..|..|.|
  Fly   351 LEPQLRDIIFKFYESKYASCLTLLDEIRDNLLVDMYIAPHVTTLYTKIRNRAL 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSN1aNP_609720.1 RPN7 105..281 CDD:287560 77/179 (43%)
CSN1bNP_524152.2 RPN7 159..338 CDD:287560 77/179 (43%)
PCI 353..457 CDD:279707 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C295672240
eggNOG 1 0.900 E1_KOG0686
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I2854
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D223526at33208
OrthoFinder 1 1.000 FOG0003750
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR14145
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.