DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN1a and csn1

DIOPT Version :8

Sequence 1:NP_609720.1 Gene:CSN1a / 34857 FlyBaseID:FBgn0028838 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_596680.1 Gene:csn1 / 2540352 PomBaseID:SPBC215.03c Length:422 Species:Schizosaccharomyces pombe

Alignment Length:347 Identity:90/348 (26%)
Similarity:147/348 (42%) Gaps:45/348 (13%)


  Fly     3 NGEETMLHLPSYADRYTDIPRLIRLKFIAQVCPELSVLALELALNHVK-TTYNVKLYDELYKTL- 65
            |.||    |..|.|.|....::.|..|:|:....|....:..|:..:| .|||::||..|::.. 
pombe     8 NQEE----LKRYLDEYGVWSKIFRALFVARNSKPLRSFCVHYAIKELKEKTYNLELYQSLFEEFQ 68

  Fly    66 -CVEVDRKYPNQSKGNEELHTTGGSEPSTSSGRGRVVVPYDSYWVEDNIMEATLMLQELDAELNF 129
             |.|           ||:|                     |..|||.........|::|..||..
pombe    69 DCFE-----------NEQL---------------------DVEWVESVTFHRKQNLEQLRRELKA 101

  Fly   130 KKSNSGSSYVRRILEEIGDHHEKSGNLQMAVKFYARARPYCTSSENVINMFRNLIRVSIYMENWW 194
            .|:|.....:|....::.......|....|::.||:.|.|||::..:.::...|:|:||::.|:.
pombe   102 YKNNLIRESIRAAQLDLASFFADVGQFDSALRSYAKVREYCTNAGQIAHLSLELMRISIWIGNYS 166

  Fly   195 HVLTYIDEAKQYAYGFENLAQEVPARLSCVAGLAHLGLKIYKSAAQYFLSTPYGRYDYDKIVAPE 259
            |||.:...||...    :.|.|:.:.:....|||:..|..|:.|..:||.....  ..|.|:...
pombe   167 HVLAFGSRAKSTV----SAAMELTSPIYAYCGLANFCLGDYEEALAHFLKVETD--TSDGIITKT 225

  Fly   260 DVTLYAGLCALATFDRETLQLNAINSEAFKPFFQLSPKMWTILAKFYAGEFDACMTLLREIENHV 324
            |:::|..|||||.:|.:.|......:|.|.....|.|.:...|......::...:..|::.....
pombe   226 DISVYISLCALACWDHKRLIQELERNEEFNALSDLDPSLRRCLQAKCNRKYSLLLDTLQQNAQDY 290

  Fly   325 RLDVYLSPHVSALYDLIMARML 346
            .||:||:|.::.|:.||..|.|
pombe   291 SLDMYLAPQLTNLFSLIRERSL 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSN1aNP_609720.1 RPN7 105..281 CDD:287560 50/176 (28%)
csn1NP_596680.1 RPN7 77..246 CDD:287560 50/175 (29%)
PCI 262..365 CDD:279707 13/52 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1225
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003750
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14145
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
77.030

Return to query results.
Submit another query.