DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN1a and csn-1

DIOPT Version :8

Sequence 1:NP_609720.1 Gene:CSN1a / 34857 FlyBaseID:FBgn0028838 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_507507.1 Gene:csn-1 / 180168 WormBaseID:WBGene00000813 Length:601 Species:Caenorhabditis elegans

Alignment Length:390 Identity:88/391 (23%)
Similarity:155/391 (40%) Gaps:73/391 (19%)


  Fly     2 DNG-----EETMLHLPSYADRYTDIPRLIRLKFIAQVCPELSVLALELALNHVKT-TYNVKLYDE 60
            |:|     .|:.:.:.|.|..|......:|.:|||:.||.|...|....:|::|. |.::..|..
 Worm    72 DDGYSLTVNESAIDIESLACSYDSNAFFLRARFIARHCPILRADAYISLINYLKEHTTDITHYVA 136

  Fly    61 LYKTLCVEVDRKYPNQSKGNEELHTTGGSEPSTSSGRGRVVVPY-DSYWVEDNIMEATLMLQELD 124
            .:..|..|:.||   :.| |.:|:               ..:|. |..|:|:|.........:|.
 Worm   137 FFNELESELARK---EFK-NRQLN---------------FQIPLRDQKWIEENGATWQSTTDQLQ 182

  Fly   125 AELNFKKSNSGSSYVRRILEEIGDHHEKSGNLQMAVKFYARA-RPYCTSSENVINMFRNLIRVSI 188
            ||....|........||.:|::..|:..:|.:..|::.|:|. |.|||..::.|||:.|.:.|:|
 Worm   183 AEYKRHKDEGVKESTRRAMEDLFQHYMMAGKIDEAIRLYSRGIRDYCTQLKHSINMWINWMEVAI 247

  Fly   189 YMENW----------WHVLTYIDEAKQYAYGFENLAQEVP------------------------- 218
            ...:|          :..|...|:|::.:    ..:|:.|                         
 Worm   248 CANDWGKLDTVTNTAYRSLKDADDAEKNS----QQSQQAPPQRGENAPYMVERDPNAPIQTLTNR 308

  Fly   219 -----ARLSCVAG--LAHLGLKIYKSAAQYFLSTPYGRYDYDKIVAPEDVTLYAGLCALATFDRE 276
                 |...|:|.  |..|..|.|....:..|............|...|:.:|..|.|:||..|.
 Worm   309 QLIETALAKCLAAQVLLKLRNKRYSQVVETILQIKTECLQSKWFVTSSDLGIYGMLSAMATMSRA 373

  Fly   277 TLQLNAINSEAFKPFFQLSPKMWTILAKFYAGEFDACMTLLREIENHVRLDVYLSPHVSALYDLI 341
            .|:|....:..|:...:..|::..:|..:.:..|..|..::|.::..:.||.::|.:|..|::.|
 Worm   374 DLKLQVSGNGTFRKLLESEPQLIELLGSYTSSRFGRCFEIMRSVKPRLLLDPFISRNVDELFEKI 438

  Fly   342  341
             Worm   439  438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSN1aNP_609720.1 RPN7 105..281 CDD:287560 50/219 (23%)
csn-1NP_507507.1 RPN7 163..378 CDD:287560 50/219 (23%)
PCI 393..495 CDD:279707 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C295385731
eggNOG 1 0.900 E1_KOG0686
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I2854
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D223526at33208
OrthoFinder 1 1.000 FOG0003750
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14145
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.