DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN1a and Gps1

DIOPT Version :9

Sequence 1:NP_609720.1 Gene:CSN1a / 34857 FlyBaseID:FBgn0028838 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_006247928.1 Gene:Gps1 / 117039 RGDID:621532 Length:536 Species:Rattus norvegicus


Alignment Length:347 Identity:139/347 - (40%)
Similarity:211/347 - (60%) Gaps:20/347 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EETMLHLPSYADRYTDIPRLIRLKFIAQVCPELSVLALELALNHVKTTYNVKLYDELYKTLCVEV 69
            |...|.|..||..|:.:.|:.||:|||..||.|.|.||::||:.|:.|:||.:|:|:::.|. |.
  Rat    77 ENPTLDLEQYAASYSGLMRIERLQFIADRCPPLRVEALKMALSFVQRTFNVDMYEEIHRKLS-EA 140

  Fly    70 DRKYPNQSKGNEELHTTGGSEPSTSSGRGRVVVPYDSYWVEDNIMEATLMLQELDAELNFKKSNS 134
            .|:..|......|    .|.||.          |.|:.|||....:|.|.|::||.:|...|.||
  Rat   141 TRELQNAPDAIPE----SGVEPP----------PLDTAWVEATRKKALLKLEKLDTDLKNYKGNS 191

  Fly   135 GSSYVRRILEEIGDHHEKSGNLQMAVKFYARARPYCTSSENVINMFRNLIRVSIYMENWWHVLTY 199
            ....:||..:::|||:...|:|..|:|.|:|||.||||:::||||..|:|:||:|::||.|||:|
  Rat   192 IKESIRRGHDDLGDHYLDCGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSY 256

  Fly   200 IDEAKQYAYGFE-----NLAQEVPARLSCVAGLAHLGLKIYKSAAQYFLSTPYGRYDYDKIVAPE 259
            :.:|:......|     :..|.:..:|.|.||||.|..:.||.||:.||...:...|:.::::|.
  Rat   257 VSKAESTPEIAERGERDSQTQAILTKLKCAAGLAELAARKYKQAAKCFLLASFDHCDFPELLSPS 321

  Fly   260 DVTLYAGLCALATFDRETLQLNAINSEAFKPFFQLSPKMWTILAKFYAGEFDACMTLLREIENHV 324
            :|.:|.||||||||||:.||.|.|:|.:||.|.:|.|::..|:.|||..::.:|:.:|.|:::::
  Rat   322 NVAVYGGLCALATFDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNL 386

  Fly   325 RLDVYLSPHVSALYDLIMARML 346
            .||:||:|||..||..|..|.|
  Rat   387 LLDMYLAPHVRTLYTQIRNRAL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN1aNP_609720.1 RPN7 105..281 CDD:287560 77/180 (43%)
Gps1XP_006247928.1 RPN7 162..343 CDD:287560 77/180 (43%)
PCI 358..462 CDD:279707 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0686
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D223526at33208
OrthoFinder 1 1.000 - - FOG0005242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14145
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.