DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN1a and Gps1

DIOPT Version :8

Sequence 1:NP_609720.1 Gene:CSN1a / 34857 FlyBaseID:FBgn0028838 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_006247927.1 Gene:Gps1 / 117039 RGDID:621532 Length:537 Species:Rattus norvegicus

Alignment Length:348 Identity:138/348 - (39%)
Similarity:212/348 - (60%) Gaps:21/348 - (6%)


  Fly     5 EETMLHLPSYADRYTDIPRLIRLKFIAQVCPELSVLALELALNHVKTTYNVKLYDELYKTLCVEV 69
            |...|.|..||..|:.:.|:.||:|||..||.|.|.||::||:.|:.|:||.:|:|:::.|. |.
  Rat    77 ENPTLDLEQYAASYSGLMRIERLQFIADRCPPLRVEALKMALSFVQRTFNVDMYEEIHRKLS-EA 140

  Fly    70 DRKYPNQSKGNEELHTTGGSEPSTSSGRGRVVVPYDSYWVEDNIMEATLMLQELDAELNFKKSNS 134
            .|:..|......|    .|.||.          |.|:.|||....:|.|.|::||.:|...|.||
  Rat   141 TRELQNAPDAIPE----SGVEPP----------PLDTAWVEATRKKALLKLEKLDTDLKNYKGNS 191

  Fly   135 GSSYVRRILEEIGDHHEKSGNLQMAVKFYARARPYCTSSENVINMFRNLIRVSIYMENWWHVLTY 199
            ....:||..:::|||:...|:|..|:|.|:|||.||||:::||||..|:|:||:|::||.|||:|
  Rat   192 IKESIRRGHDDLGDHYLDCGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSY 256

  Fly   200 IDEAK------QYAYGFENLAQEVPARLSCVAGLAHLGLKIYKSAAQYFLSTPYGRYDYDKIVAP 258
            :.:|:      :.....::..|.:..:|.|.||||.|..:.||.||:.||...:...|:.::::|
  Rat   257 VSKAESTPEIAEQRGERDSQTQAILTKLKCAAGLAELAARKYKQAAKCFLLASFDHCDFPELLSP 321

  Fly   259 EDVTLYAGLCALATFDRETLQLNAINSEAFKPFFQLSPKMWTILAKFYAGEFDACMTLLREIENH 323
            .:|.:|.||||||||||:.||.|.|:|.:||.|.:|.|::..|:.|||..::.:|:.:|.|::::
  Rat   322 SNVAVYGGLCALATFDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDN 386

  Fly   324 VRLDVYLSPHVSALYDLIMARML 346
            :.||:||:|||..||..|..|.|
  Rat   387 LLLDMYLAPHVRTLYTQIRNRAL 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSN1aNP_609720.1 RPN7 105..281 CDD:287560 76/181 (42%)
Gps1XP_006247927.1 RPN7 162..344 CDD:287560 76/181 (42%)
PCI 359..463 CDD:279707 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0686
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D223526at33208
OrthoFinder 1 1.000 FOG0003750
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14145
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.