DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)34Fc and si:dkey-251i10.2

Sequence 1:NP_001285930.1 Gene:l(2)34Fc FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001313480.1 Gene:si:dkey-251i10.2 ZFINID:ZDB-GENE-050506-102 Length:193 Species:Danio rerio

Alignment Length:145 Identity:51/146 (35%)
Similarity:83/146 (57%) Gaps:7/146 (5%)


  Fly    15 VHAYSDGAPKAACRDLTPQHGAKLQVTKPPYSISGPS-HVRSDQKLTLTLGGDEFLGFMIQARDG 78
            ||:|..|||.:||.|:.|:||.:.|....||:|...| ..::...:|:.:.|.::.|.:::||.|
Zfish    18 VHSYGTGAPTSACGDMIPRHGVQPQPNPAPYTIQASSTKFQAGIPITVVIKGPDYKGVLLEARSG 82

  Fly    79 QN-RVVGQFQVVDSVHSQTLDCSG-KDDTITHLSAQKGKPLTGITFDWIPPAGYKGNVKFMATVV 141
            .: ..:|.:| :...:::.|:||| |...|||.:|......|  .:.|:|||..| |:.||||||
Zfish    83 SDTTALGSWQ-MPPANTKFLECSGNKQGAITHSNANVKNNST--VYTWVPPATTK-NIMFMATVV 143

  Fly   142 QTGFVYWVGRVTKDI 156
            |...|:||..::..:
Zfish   144 QQRNVFWVNVMSSSL 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 43/125 (34%)
si:dkey-251i10.2NP_001313480.1 Reeler 30..151 CDD:280232 43/125 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110118498
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5052
OMA 1 1.010
OrthoDB 1 1.010 D1223313at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1052902
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45828
Phylome 1 0.910 0.625 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.