DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)34Fc and Frrs1

Sequence 1:NP_001285930.1 Gene:l(2)34Fc FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_008759696.1 Gene:Frrs1 RGDID:1306883 Length:592 Species:Rattus norvegicus

Alignment Length:154 Identity:50/155 (32%)
Similarity:78/155 (50%) Gaps:10/155 (6%)


  Fly     2 FRLLVLAACLAI-SVHAYSDGAPKAACRDLTPQHGAKLQVTKPPYSIS-GPSHVRSDQKLTLTLG 64
            |.|.||...|.| ||.||.:|....:|..:.|||....| :.|.:.|: .....:...::.:||.
  Rat     6 FTLSVLVCALLICSVTAYPNGRVARSCAGMIPQHNHSPQ-SDPVHKITVSQMKFKPGDQIKVTLS 69

  Fly    65 GDEFLGFMIQARDGQN---RVVGQFQVVDSVHSQTLDCSG-KDDTITHLSAQKGKPLTGITFDWI 125
            |..|.||:::||:.::   ..:|.|.::||..||.|.|.. :...::|.|:   ...|.|...|.
  Rat    70 GPPFRGFLLEARNAEDLSGPPIGTFTLIDSDSSQILTCEDVQGFAVSHTSS---SIKTEIKVYWN 131

  Fly   126 PPAGYKGNVKFMATVVQTGFVYWV 149
            .|:....:|:|:|||||...:|||
  Rat   132 APSSAPDHVQFLATVVQKYKIYWV 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 38/127 (30%)
Frrs1XP_008759696.1 Reeler 32..155 CDD:280232 38/127 (30%)
DOMON_SDR_2_like 192..354 CDD:187686
Cyt_b561_FRRS1_like 320..533 CDD:176490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110129755
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001122
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45828
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.