DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)34Fc and Frrs1

Sequence 1:NP_001285930.1 Gene:l(2)34Fc FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001106950.1 Gene:Frrs1 MGIID:108076 Length:592 Species:Mus musculus

Alignment Length:150 Identity:47/150 (31%)
Similarity:79/150 (53%) Gaps:9/150 (6%)


  Fly     5 LVLAACLAISVHAYSDGAPKAACRDLTPQHGAKLQVTKPPYSIS-GPSHVRSDQKLTLTLGGDEF 68
            :::.|.|..||.||.:|....:|..:.|||....| ::|.:.|: ..:..:...::.:||.|..|
Mouse    10 VLVIALLTCSVTAYPNGKVPMSCGGMIPQHNHSPQ-SEPIHQITVSQTTFKPGDQIKVTLSGPPF 73

  Fly    69 LGFMIQARDGQN---RVVGQFQVVDSVHSQTLDCSGKDD-TITHLSAQKGKPLTGITFDWIPPAG 129
            .||:::|||.:|   ..:|.|.::||..||.|.|:.... .::|..:.|   .|.|...|..|:.
Mouse    74 RGFLLEARDAENLSGPPIGSFTLIDSEESQLLTCTDVQGLAVSHTRSSK---KTEIKVYWDAPSP 135

  Fly   130 YKGNVKFMATVVQTGFVYWV 149
            ...:::|:|||||...:|||
Mouse   136 APDHIRFLATVVQKFKIYWV 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 39/127 (31%)
Frrs1NP_001106950.1 Reeler 32..155 CDD:280232 39/127 (31%)
DOMON_SDR_2_like 192..354 CDD:187686
Cyt_b561_FRRS1_like 320..533 CDD:176490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110129502
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7160
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001122
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45828
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3670
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.