DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)34Fc and M03A1.3

Sequence 1:NP_001285930.1 Gene:l(2)34Fc FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_494805.3 Gene:M03A1.3 WormBaseID:WBGene00019746 Length:352 Species:Caenorhabditis elegans

Alignment Length:133 Identity:27/134 (20%)
Similarity:46/134 (34%) Gaps:40/134 (30%)


  Fly    58 KLTLTLGGDEFLGFMIQARDGQNRVVGQFQVVDSVHSQTL-DCSGKDDTITHLSAQ-------KG 114
            |:|||..||. |...|.   .:|..:.:..::.......| ||:.|.:......||       |.
 Worm    35 KVTLTRTGDS-LNLRIY---DENSAIRKVHILQKEGKDVLVDCTNKKEDGKTCEAQLTVDQFEKN 95

  Fly   115 KPLT----------GITFDWIPPAGYKGNVKFM----------------ATVVQTGFVYWVGRVT 153
            .|::          .|:.:.:.|...:|..|..                ...|.:||::  .|:.
 Worm    96 LPISIKLSDSQTSDPISLEALVPPAQEGLTKQQRRQFSKAHAILMIFGWLLFVPSGFLF--ARLG 158

  Fly   154 KDI 156
            ||:
 Worm   159 KDL 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 24/125 (19%)
M03A1.3NP_494805.3 Cyt_b561_FRRS1_like 99..305 CDD:176490 10/66 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110047851
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7160
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45828
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.980

Return to query results.
Submit another query.