DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)34Fc and si:ch73-196i15.3

Sequence 1:NP_001285930.1 Gene:l(2)34Fc FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001315196.1 Gene:si:ch73-196i15.3 ZFINID:ZDB-GENE-091116-4 Length:270 Species:Danio rerio

Alignment Length:155 Identity:43/156 (28%)
Similarity:67/156 (43%) Gaps:20/156 (13%)


  Fly     4 LLVLAACLAISVHAYSDGAPKA-ACRDLTPQHGAKLQ-------VTKPPYSISGPSHVRSDQKLT 60
            ||:....:...:..||||:... .|:.:...|||:..       ...|.|.|...|.|.:...:|
Zfish     9 LLIFGFTMLRFICCYSDGSLLTDHCQSMAIDHGAQASGQDSNPFTVAPDYVIVDSSQVGTGITVT 73

  Fly    61 LTLGGDEFLGFMIQARDGQN-RVVGQFQVVDSVHSQTLDCSGKDDTITH-LSAQKGKPLTGITFD 123
            |:.....|:|||::||:..: ...|.|.|:|  .:..|.|||:  .:.| ||:.|    :.:...
Zfish    74 LSASSGSFMGFMLEARECDDCPPAGSFSVLD--FNSLLLCSGQ--VVAHSLSSDK----SSVQVT 130

  Fly   124 WIPPAGYKGNVKFMATVVQTGFVYW 148
            |.|.|  .|...|.|..|:....:|
Zfish   131 WTPQA--TGQFFFRAAFVKNFIEFW 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 37/132 (28%)
si:ch73-196i15.3NP_001315196.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001122
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45828
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.