DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)34Fc and LOC100489839

Sequence 1:NP_001285930.1 Gene:l(2)34Fc FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_017949106.1 Gene:LOC100489839 ID: Length:550 Species:Xenopus tropicalis

Alignment Length:155 Identity:52/156 (33%)
Similarity:82/156 (53%) Gaps:12/156 (8%)


  Fly     3 RLLVLAACLAISVHAYSDGAPKAACRDLTPQH-GAKLQVTKPPYSIS-GPSHVRSDQKLTLTL-- 63
            |||||.:....||.::..|...|:|..:.||| |:..|.|..||.|: ..:..:|..::|:|:  
 Frog     4 RLLVLFSGYFASVFSFPSGQISASCDTMLPQHRGSTPQTTASPYFITVSNTTFKSGDRITVTIQS 68

  Fly    64 -GGDEFLGFMIQARD-GQNRVVGQFQVVDSVHSQTLDCS-GKDDTITHLSAQKGKPLTGITFDWI 125
             .|:.|.||:::|.. |.:.|.|.|.:.:. .:|.|.|| |.:..::|.|   ....:.||..|.
 Frog    69 NSGNTFKGFLLEALSVGGDTVTGTFTITNG-DTQGLSCSAGPNSAVSHTS---DSSKSSITTSWT 129

  Fly   126 PPAGYKGNVKFMATVVQTGFVYWVG 150
            .|:| .|.|:|.|||:|:...:|.|
 Frog   130 APSG-AGPVRFRATVLQSFSTFWSG 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 42/129 (33%)
LOC100489839XP_017949106.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001122
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.