DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)34Fc and si:ch73-196i15.5

DIOPT Version :9

Sequence 1:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_021334085.1 Gene:si:ch73-196i15.5 / 100332242 ZFINID:ZDB-GENE-091118-32 Length:579 Species:Danio rerio


Alignment Length:160 Identity:41/160 - (25%)
Similarity:64/160 - (40%) Gaps:40/160 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVLAACLAISVHAYSDGAPKA-ACRDLTPQHGAKLQVTKPP------YSISGPSHVRSDQK--- 58
            ||:....:...:..||||:... .|:.:...||     .:||      :|:. |.:|..|..   
Zfish     9 LLIFGFTMLRFIGCYSDGSLLTDQCQSMAIDHG-----VQPPGQDSIIFSVD-PDNVIVDSSQVG 67

  Fly    59 --LTLTLGGD-EFLGFMIQARDGQN-RVVGQFQVVDSVHS------QTLDCSGKDDTITHLSAQK 113
              :|:||... .|:|||::||:..: ...|.|.::|.|:|      |.:.....||.        
Zfish    68 TGITVTLSSSGSFMGFMLEARECDDCPPAGTFSLLDPVNSLLLCGDQAVAQPNNDDK-------- 124

  Fly   114 GKPLTGITFDWIPPAGYKGNVKFMATVVQT 143
                |.:...|.|.|  .|...|.|..||:
Zfish   125 ----TSVLVTWTPQA--TGQFYFRAAFVQS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 35/136 (26%)
si:ch73-196i15.5XP_021334085.1 Reeler 33..150 CDD:307916 35/136 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.