DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)34Fc and zgc:163022

DIOPT Version :9

Sequence 1:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001083026.2 Gene:zgc:163022 / 100038777 ZFINID:ZDB-GENE-070424-101 Length:570 Species:Danio rerio


Alignment Length:153 Identity:49/153 - (32%)
Similarity:78/153 - (50%) Gaps:12/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVLAACLAISVHAYSDGAPKAACRDLTPQHGAKLQVTKPPYSISG--PSHVRSDQ-KLTL-TLG 64
            |.:|..|:.: |.:|.:|.....|..:.|.|||..|.:.||::::.  .:....|| |:|| :..
Zfish    12 LFILVLCVGL-VQSYKNGLVSEVCDSMMPNHGANAQTSSPPFTVTADKTTFKEGDQIKVTLNSQT 75

  Fly    65 GDEFLGFMIQARD-GQNRVVGQFQVVDSVHSQTLDCSGKDD-TITHLSAQKGKPLTGITFDW-IP 126
            |..|.|||:|||. |.:..:|.|.|..: :.|.|.|:|... .::|.|..|   .|.:...| .|
Zfish    76 GYYFEGFMLQARPVGSSSTIGTFSVTGN-NVQVLSCNGMPGRAVSHTSNAK---TTSVQVTWTAP 136

  Fly   127 PAGYKGNVKFMATVVQTGFVYWV 149
            .:|..||::|..|.|::...:||
Zfish   137 TSGQLGNIEFSVTFVKSTLTFWV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 41/128 (32%)
zgc:163022NP_001083026.2 Reeler 34..159 CDD:307916 41/128 (32%)
DOMON_SDR_2_like 186..343 CDD:187686
Cyt_b561_FRRS1_like 314..525 CDD:176490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001198
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.