DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)34Fc and zgc:163022

Sequence 1:NP_001285930.1 Gene:l(2)34Fc FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001083026.2 Gene:zgc:163022 ZFINID:ZDB-GENE-070424-101 Length:570 Species:Danio rerio

Alignment Length:153 Identity:49/154 (32%)
Similarity:78/154 (51%) Gaps:12/154 (8%)


  Fly     4 LLVLAACLAISVHAYSDGAPKAACRDLTPQHGAKLQVTKPPYSISG--PSHVRSDQ-KLTL-TLG 64
            |.:|..|:.: |.:|.:|.....|..:.|.|||..|.:.||::::.  .:....|| |:|| :..
Zfish    12 LFILVLCVGL-VQSYKNGLVSEVCDSMMPNHGANAQTSSPPFTVTADKTTFKEGDQIKVTLNSQT 75

  Fly    65 GDEFLGFMIQARD-GQNRVVGQFQVVDSVHSQTLDCSGKDD-TITHLSAQKGKPLTGITFDW-IP 126
            |..|.|||:|||. |.:..:|.|.|..: :.|.|.|:|... .::|.|..|   .|.:...| .|
Zfish    76 GYYFEGFMLQARPVGSSSTIGTFSVTGN-NVQVLSCNGMPGRAVSHTSNAK---TTSVQVTWTAP 136

  Fly   127 PAGYKGNVKFMATVVQTGFVYWV 149
            .:|..||::|..|.|::...:||
Zfish   137 TSGQLGNIEFSVTFVKSTLTFWV 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 42/129 (33%)
zgc:163022NP_001083026.2 Reeler 34..159 CDD:307916 42/129 (33%)
DOMON_SDR_2_like 186..343 CDD:187686
Cyt_b561_FRRS1_like 314..525 CDD:176490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110115752
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001122
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45828
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.