powered by:
                   
 
    
    
             
          
            Protein Alignment l(2)34Fc and si:ch73-14h1.2
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001285930.1 | Gene: | l(2)34Fc / 34838 | FlyBaseID: | FBgn0261534 | Length: | 159 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | XP_003197897.1 | Gene: | si:ch73-14h1.2 / 100004603 | ZFINID: | ZDB-GENE-070912-263 | Length: | 326 | Species: | Danio rerio | 
        
        
        
          
            | Alignment Length: | 154 | Identity: | 51/154 - (33%) | 
          
            | Similarity: | 75/154 -  (48%) | Gaps: | 11/154 - (7%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     2 FRLLVLAACLAISVHAYSDGAPKAACRDLTPQHGAKLQVTK--PPYSISGPSHVRSD-QKLTLTL 63|.|||....|. :|.||..|.....|..:.|.|......|.  .||:::......:| |.:|:||
 Zfish    76 FVLLVFVLNLQ-AVTAYPHGRVSGVCSSMVPGHNGTYSSTNLDSPYTVTSDVLYYTDGQVITVTL 139
 
 
  Fly    64 GGD--EFLGFMIQARDGQNRVVGQFQVVDSVHSQTLDCSGKDDTITHLSAQKGKPLTGITFDWIP 126.|:  ||.||::|||:|. ..||.|.:|.: .||.|:|..:...::|.|:..   .:.:...|..
 Zfish   140 QGNNTEFRGFLLQARNGM-EPVGTFTIVGN-SSQLLNCGTEGSAVSHNSSTL---KSTVVAQWNA 199
 
 
  Fly   127 PAGYKGNVKFMATVVQTGFVYWVG 150|.....:::|.||.||...|||||
 Zfish   200 PNINNTDIQFRATFVQNFSVYWVG 223
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
          
          
            | Gene | Sequence | Domain | Region | External ID | Identity | 
          
            | l(2)34Fc | NP_001285930.1 | Reeler | 27..149 | CDD:280232 | 39/126 (31%) | 
          
            | si:ch73-14h1.2 | XP_003197897.1 | Reeler | 100..222 | CDD:280232 | 39/126 (31%) | 
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_2E0SP | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | O | PTHR45828 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 1 | 0.960 | - | - |  |  | 
          
            | ZFIN | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 4 | 3.870 |  | 
        
      
           
             Return to query results.
             Submit another query.