DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG46301 and NOL4

Sequence 1:NP_001334737.1 Gene:CG46301 FlyBaseID:FBgn0283651 Length:1237 Species:Drosophila melanogaster
Sequence 2:NP_003778.2 Gene:NOL4 HGNCID:7870 Length:638 Species:Homo sapiens

Alignment Length:1179 Identity:291/1180 (25%)
Similarity:403/1180 (34%) Gaps:559/1180 (47%)


  Fly    73 AEREIIYELFQPWALSTYGDQAKTKTITLRKKARILKALEGKEHSRPDSSKFRFWVKTKGFTTNR 137
            :||: :|..||.|.|.||||..||||:|.:|..||::.|.|.|.|..|::||:||||:|||...:
Human     3 SERD-MYRQFQDWCLRTYGDSGKTKTVTRKKYERIVQLLNGSESSSTDNAKFKFWVKSKGFQLGQ 66

  Fly   138 PEGFEEAPGSRRHLKNLPSSAILSDNPADVDLFAASTSKGFG---RRTYRKVACVEEFFDIIYNV 199
            |:......|..:.:..:|                ..|:.|.|   :.:.|:||.||:||||||::
Human    67 PDEVRGGGGGAKQVLYVP----------------VKTTDGVGVDEKLSLRRVAVVEDFFDIIYSM 115

  Fly   200 HMELGGRSGM---HAGQKRTYRIITETYAFLPREAVTRFLTICPECKKNLRPSSPSGGGKDSDLA 261
            |:|.|.....   ||||||||:.|:|:|||||||||||||..|.||:|.:. .:|.|        
Human   116 HVETGPNGEQIRKHAGQKRTYKAISESYAFLPREAVTRFLMSCSECQKRMH-LNPDG-------- 171

  Fly   262 GNESSSEVENYLNYSSHTESSLEAGPTAKRRRHSSAEIKASLASGLAVGAGVASSMSATQLDVLW 326
                          :.|.::.                                            
Human   172 --------------TDHKDNG-------------------------------------------- 178

  Fly   327 TGVPRSRSPKPPMAAEAAVE-TTPVSVPKIR-IKTQLQRPSSPQDQSPADPN----TDAQSQSQI 385
                     |||....:.:: ..|:::..:: :|.||......:|:|..:.:    :|:...|.:
Human   179 ---------KPPTLVTSMIDYNMPITMAYMKHMKLQLLNSQQDEDESSIESDEFDMSDSTRMSAV 234

  Fly   386 QSQSQSQSQSQSQSHSQPSGQGFDAQLLKSRDNLLRYYNFMRRFYAGEPVLAPPIYGSSLLQSLS 450
            .|...|..:.:.||.....||..|       |:....:|       |...|     |.|      
Human   235 NSDLSSNLEERMQSPQNLHGQQDD-------DSAAESFN-------GNETL-----GHS------ 274

  Fly   451 YPTTISTAATATPTTPTTTTSAPGKMLAPPKTATPPPNPPKIKTSPDSLLRARTPPVASTATSAA 515
                 |.|:..|.:.....:::.||                                     :..
Human   275 -----SIASGGTHSREMGDSNSDGK-------------------------------------TGL 297

  Fly   516 PKDAAHTPINLTKSLFSSLKTGHAPSTSTPVPLKLELPSPPKPLPELRIPQLRGMPPVELSLPLP 580
            .:|  ..|:||:.|                 ||..:|                            
Human   298 EQD--EQPLNLSDS-----------------PLSAQL---------------------------- 315

  Fly   581 PLDLERLKPITSTYLQLTRSMGLSDEDALRFDNLETIPATPVVSTDTASVVGVGVGGGGGAAAGA 645
                      ||.|               |.|:..:                             
Human   316 ----------TSEY---------------RIDDHNS----------------------------- 326

  Fly   646 GGGAGGAGGLLGDVVSGLGGGLVNESEAYAGLMKDADKLKLMLLAWNYQNSTAVRNGTEGPDLSV 710
                                             ...:|.|.:|::.......|..||::.|..| 
Human   327 ---------------------------------NGKNKYKNLLISDLKMEREARENGSKSPAHS- 357

  Fly   711 VGGLWAQYQNALAQNAAAAAAASGKMDSSLSPVPRQDAHSPMETQDETNSSGQKEEDEVSEDDSD 775
                ::.|.             |||.:|             ::...|..|..:.:|||...:|.|
Human   358 ----YSSYD-------------SGKNES-------------VDRGAEDLSLNRGDEDEDDHEDHD 392

  Fly   776 DKLDEKLATTH--DPERLKAFNMFVRLFVDENLDRIIPISKQPKEKIQAIIDSCARQFPEFSDRS 838
            |  .||:..|.  :.||||||||||||||||||||::|||||||||||||||||.|||||:.:|:
Human   393 D--SEKVNETDGVEAERLKAFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQERA 455

  Fly   839 RKRIRTYLKSCRRNKKTRDGWENTTRPTPAHLTSVQAEQILAIACENESMN-AKRMRIGLEPITH 902
            |||||||||||||.|  |.|:| .:||.|:||||..||.|||.|||:||.| |||||:..:. ..
Human   456 RKRIRTYLKSCRRMK--RSGFE-MSRPIPSHLTSAVAESILASACESESRNAAKRMRLERQQ-DE 516

  Fly   903 AVPAPGSAVAAAAAAAAAAAVVAATSSSAGGTSTTAAGNATATCGMGGVGDATGLTSAAAAALPF 967
            :.||.......|.                                     .||..|||       
Human   517 SAPADKQCKPEAT-------------------------------------QATYSTSA------- 537

  Fly   968 VSAVGFARSTPNSEHADVLPFGGAGTAGGSGGGGAGGGGGGGMSSARSSPLALSSNASVSGGASV 1032
                     .|.|:  |||...|.||.......|.|||            |...::||.||    
Human   538 ---------VPGSQ--DVLYINGNGTYSYHSYRGLGGG------------LLNLNDASSSG---- 575

  Fly  1033 TGLTLANGAGASNGAGLPASSPYTTDFSSPSTASPFVAAAAAVAAGRAPSYPGYFPAVAGLGNVT 1097
                                                                             
Human   576 ----------------------------------------------------------------- 575

  Fly  1098 PTDLSMKPTSGLGGNMVSNNNSNSSVTGNINSQLSAANLASLSNASNNNALVTATQQLQQLQQQQ 1162
            |||||||      ..:.:::.|:||                    ||:..               
Human   576 PTDLSMK------RQLATSSGSSSS--------------------SNSRP--------------- 599

  Fly  1163 QQQQQQQQQQQQQQLLVAGGGGMDGQSVRAPPILPHKLSANEVTAARQVISAYRESAAFLLRTAD 1227
                                                :||..|:.|.||:::.||||||||||:||
Human   600 ------------------------------------QLSPTEINAVRQLVAGYRESAAFLLRSAD 628

  Fly  1228 QVEQLLVQQ 1236
            ::|.|::||
Human   629 ELENLILQQ 637



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28ISH
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3485
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002684
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132908
Panther 1 1.100 O PTHR12449
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5484
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.