DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG46301 and nol4lb

Sequence 1:NP_001334737.1 Gene:CG46301 FlyBaseID:FBgn0283651 Length:1237 Species:Drosophila melanogaster
Sequence 2:XP_009295021.1 Gene:nol4lb ZFINID:ZDB-GENE-070112-1702 Length:704 Species:Danio rerio

Alignment Length:1190 Identity:302/1191 (25%)
Similarity:423/1191 (36%) Gaps:526/1191 (44%)


  Fly    71 PTAEREIIYELFQPWALSTYGDQAKTKTITLRKKARILKALEGKE-------HSRPDSSKFRFWV 128
            |......::..||.|.|.||||..||||:|.||..:||:.|...:       .|...::||:|||
Zfish    16 PAVSEAEMFGDFQEWCLRTYGDSGKTKTVTRRKYNKILQTLLQSDDSEGVIIESNHINAKFKFWV 80

  Fly   129 KTKGFTTNRPEGFEEAPGSRRHLKNLPSSAILSDNPADVDLFAASTSKGFGRRTYRKVACVEEFF 193
            |:|||...|.|...|...:.|.:..:|..|...|.....|           ..:.::||.||:|:
Zfish    81 KSKGFQVGRSESENENGAADRPVLYVPIKATCVDGVLGPD-----------GSSLKRVAVVEDFY 134

  Fly   194 DIIYNVHMELG---GRSGMHAGQKRTYRIITETYAFLPREAVTRFLTICPECKKNLRPSSPSGGG 255
            ||||.:|:|:.   .::..|||||:||:.|.|||||||||||||||..|.||:|.:. .||||..
Zfish   135 DIIYAMHVEISSDPAKAPKHAGQKKTYKAIAETYAFLPREAVTRFLMSCGECQKRMH-ISPSGAE 198

  Fly   256 -KDSDLAGNESSSEVENYLNYSSH-TESSLEAGPTAKRRRHSSAEIKASLASGLAVGAGVASSMS 318
             |::    |:.||...:.::|:.. |.:.|:.........:...|                .|:|
Zfish   199 FKEN----NQPSSLAADLIDYNMPLTTTYLKQKKLQCMNNNEQDE----------------CSVS 243

  Fly   319 ATQLDVLWTGVPRSRSPKPPMAAEAAVETTPVSVPKIRIKTQLQRPSSPQDQSPADPNTDAQSQS 383
            :.:.|:                    .:.|.:|..:....:.|..|||      ||         
Zfish   244 SEEFDM--------------------SDPTWISAERHGTLSDLNHPSS------AD--------- 273

  Fly   384 QIQSQSQSQSQSQSQSHSQPSGQGFDAQLLKSRDNLLRYYNFMRRFYAGEPVLAPPIYGSSLLQS 448
            ::.|...:..:....|.|: ||.|                |.:|       .|.||..|::.:..
Zfish   274 RMHSPQNAHKEEDDDSSSE-SGSG----------------NGIR-------TLTPPSVGAAGVND 314

  Fly   449 LSYPTTISTA-----ATATPTTPTTTTSAPGKMLAPPKTATPPPNPPKIKTSPDSLLRARTPPVA 508
            .:.|.:.|.|     :||.|...:||:|                                     
Zfish   315 STGPGSGSYAEVNGNSTAAPLDFSTTSS------------------------------------- 342

  Fly   509 STATSAAPKDAAHTPINLTKSLFSSLKTGHAP-STSTPVPLKLELPSPPKPLPELRIPQLRGMPP 572
                |::.:|  ..|:||:..|..:|.|..|. :|.|           |:...|||    |..| 
Zfish   343 ----SSSSED--QQPVNLSDRLSQALPTAAAMLATFT-----------PEHTEELR----RKYP- 385

  Fly   573 VELSLPLPPLDLERLKPITSTYLQLTRSMGLSDEDALRFDNLETIPATPVVSTDTASVVGVGVGG 637
                              .||.|:|.|.:.                                   
Zfish   386 ------------------KSTELRLDRDIR----------------------------------- 397

  Fly   638 GGGAAAGAGGGAGGAGGLLGDVVSGLGGGLVNESEAYAGLMKDADKLKLMLLAWNYQNSTAVRNG 702
                                                                  :|.|.:     
Zfish   398 ------------------------------------------------------DYNNKS----- 403

  Fly   703 TEGPDLSVVGGLWAQYQNALAQNAAAAAAASGKMDSSLSPVPRQDAHSPMETQDETNSSGQKEED 767
                         .||             :||..||....:..:|.     |...:.::...::|
Zfish   404 -------------PQY-------------SSGSYDSIKMEICAEDL-----TVGRSQAADDDDDD 437

  Fly   768 EVSEDDSDDKLDEKLATTHDPERLKAFNMFVRLFVDENLDRIIPISKQPKEKIQAIIDSCARQFP 832
            ....||| ||:::....  ||||||||||||||||||||||::||||||||||||||:||:||||
Zfish   438 HDDHDDS-DKINDVEGV--DPERLKAFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFP 499

  Fly   833 EFSDRSRKRIRTYLKSCRRNKKTRDGWENTTRPTPAHLTSVQAEQILAIACENESMN-AKRMRIG 896
            ||.:|:|||||||||||||.||  :|.|. |||||.||||..||.|||.|||:||.. |||||:.
Zfish   500 EFQERARKRIRTYLKSCRRMKK--NGMEQ-TRPTPPHLTSAMAENILAAACESESRKAAKRMRMD 561

  Fly   897 L-----EPITHAVPAPGSAVAAAAAAAAAAAVVAATSSSAGGTSTTAAGNATATCGMGGVGDATG 956
            :     ||:             :...|.:...|:.|.                            
Zfish   562 VYQAHEEPV-------------SLDKAVSREPVSLTH---------------------------- 585

  Fly   957 LTSAAAAALPFVSAVGFARSTPNSEHADVLPFGGAGTAGGSGGGGAGGGGGGGMSSARSSPLALS 1021
                        ||...|.|..:.:...:           :||......|.||:.::...|:.|:
Zfish   586 ------------SAYSLAASAYSQDQLYI-----------NGGLNYSYRGYGGLCASMQHPVTLN 627

  Fly  1022 SNASVSGGASVTGLTLANGAGASNGAGLPASSPYTTDFSSPSTASPFVAAAAAVAAGRAPSYPGY 1086
            :..:.:.|                                                         
Zfish   628 TATAQTNG--------------------------------------------------------- 635

  Fly  1087 FPAVAGLGNVTPTDLSMKPTSGLGGNMVSNNNSNSSVTGNINSQLSAANLASLSNASNNNALVTA 1151
                       |||||||       ::.||::|:||                 |:...|      
Zfish   636 -----------PTDLSMK-------SLASNSSSSSS-----------------SSLGRN------ 659

  Fly  1152 TQQLQQLQQQQQQQQQQQQQQQQQQLLVAGGGGMDGQSVRAPPILPHKLSANEVTAARQVISAYR 1216
                                          |||...|           ||..||.|.||:|:.||
Zfish   660 ------------------------------GGGASTQ-----------LSHTEVAAVRQLIAGYR 683

  Fly  1217 ESAAFLLRTADQVEQLLVQQ 1236
            ||||||||:||::|.|::||
Zfish   684 ESAAFLLRSADELENLILQQ 703



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28ISH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3437
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002684
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132908
Panther 1 1.100 LDO PTHR12449
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5484
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.