DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG46301 and nol4la

Sequence 1:NP_001334737.1 Gene:CG46301 FlyBaseID:FBgn0283651 Length:1237 Species:Drosophila melanogaster
Sequence 2:XP_001922545.4 Gene:nol4la ZFINID:ZDB-GENE-081105-118 Length:691 Species:Danio rerio

Alignment Length:1208 Identity:314/1209 (26%)
Similarity:405/1209 (33%) Gaps:583/1209 (48%)


  Fly    74 EREIIYELFQPWALSTYGDQAKTKTITLRKKARILKALEGKEHS---RPDSS----KFRFWVKTK 131
            |.|:..| ||.|.|.||||..||||:|.||..:|::.|...|.|   ..|:|    ||:||||:|
Zfish    21 EAEMFSE-FQDWCLRTYGDSGKTKTVTRRKYNKIMQTLLQNEESDGVYVDNSHINAKFKFWVKSK 84

  Fly   132 GFTT--------NRPEGFEEAPGSRRHLKNLPSSAILSDNPADVDLFAASTSKGFGRRTYRKVAC 188
            ||..        |:.|      .|.:.:..:|..:..||.....|            .:.::||.
Zfish    85 GFQVGSNILGEHNKKE------SSGKPVLYVPVKSTCSDGGTAQD------------SSLKRVAV 131

  Fly   189 VEEFFDIIYNVHMELG---GRSGMHAGQKRTYRIITETYAFLPREAVTRFLTICPECKKNLRPSS 250
            ||:||||||.:|:|:|   ||:..|||||:||:.|.|||||||||||||||..|.||:|.:..:.
Zfish   132 VEDFFDIIYAMHVEMGADPGRAPKHAGQKKTYKAIAETYAFLPREAVTRFLMSCGECQKRMHINP 196

  Fly   251 PSGGGKDSDLAGNESSSEVENYLNYSSHTESSLEAGPTAKRRRHSSAEIKASLASGLAVGAGVAS 315
            .:...|::|    ..:|.|.:.::|:                                      .
Zfish   197 STAEFKEND----RPTSLVPDLIDYN--------------------------------------M 219

  Fly   316 SMSATQLDVLWTGVPRSRSPKPPMAAEAAVETTPVSVPKIRIKTQLQRPSSPQDQSPADPNTDAQ 380
            .::||.|.                                ::|.|..             ||:.|
Zfish   220 PLTATYLK--------------------------------QMKLQCM-------------NTNEQ 239

  Fly   381 SQSQIQSQSQSQSQSQSQSHSQPSGQGFDAQLLKSRDNLLRYYNFMRRFYAGEPVLAPPIYGSSL 445
            .:|.:.|:....::                                                   
Zfish   240 DESSVSSEDLDMAE--------------------------------------------------- 253

  Fly   446 LQSLSYPTTIST--AATATPTTPTTTTSAPGKMLAPPKTATPPPNPPKIKTSPDSL--------- 499
                  |..:||  |..|.|::|.          ||.....|.|..|.||...|..         
Zfish   254 ------PAWVSTERAPAADPSSPA----------APYTERMPTPPQPNIKEEEDDSSSENGSTAN 302

  Fly   500 -LRARTPP-VASTATSAAPKDAAHTPINLTKSLFSSLKTGHAPSTSTPVPLKLELPSPPKPLPEL 562
             |.|.||| .|:.||...|......|.            |.........||.....|...     
Zfish   303 GLPALTPPGGAAMATGGVPASEGVVPY------------GEVNGNGAAAPLDFSTSSSSS----- 350

  Fly   563 RIPQLRGMPPVELSLPLPPLDLERLKPITSTYLQLTRSMGLSDEDALRFDNLETIPATPVVSTDT 627
               ...|..||.||        :||.|                                      
Zfish   351 ---SQEGQQPVNLS--------DRLLP-------------------------------------- 366

  Fly   628 ASVVGVGVGGGGGAAAGAGGGAGGAGGLLGDVVSGLGGGLVNESEAYAGLMKDADKLKLMLLAWN 692
                ||.:|                                    :||     :|..:...:...
Zfish   367 ----GVTLG------------------------------------SYA-----SDPSRKFPVKTE 386

  Fly   693 YQNSTAVRNGTEGPDLSVVGGLWAQYQNALAQNAAAAAAASGKMDSSLSPVPRQDAHSPMETQDE 757
            |        |.:.|          ||             :||..||         ..:.:.|..|
Zfish   387 Y--------GNKSP----------QY-------------SSGSYDS---------VKTELSTCGE 411

  Fly   758 TNSSGQKEEDEVSEDDSDDKLD-EKL--ATTHDPERLKAFNMFVRLFVDENLDRIIPISKQPKEK 819
            ..:.|:.:..:..:||.||..| :|:  |...||||||||||||||||||||||::|||||||||
Zfish   412 DMTPGRSQVIDDDDDDHDDHDDSDKINDAEGLDPERLKAFNMFVRLFVDENLDRMVPISKQPKEK 476

  Fly   820 IQAIIDSCARQFPEFSDRSRKRIRTYLKSCRRNKKTRDGWENTTRPTPAHLTSVQAEQILAIACE 884
            |||||:||:||||||.:|||||||||||||||.||  .|:|  :||||.||||..||.|||.|||
Zfish   477 IQAIIESCSRQFPEFQERSRKRIRTYLKSCRRMKK--GGFE--SRPTPPHLTSAMAENILAAACE 537

  Fly   885 NESMN-AKRMRIGLEPITHAVPAPGSAVAAAAAAAAAAAVVAATSSSAGGTSTTAAGNATATCGM 948
            :|:.| |||||:.:                               ..|...||||          
Zfish   538 SETRNAAKRMRLDI-------------------------------YQAHDESTTA---------- 561

  Fly   949 GGVGDATGLTSAAAAALPFVSAVGFARSTPNSEHADVLPFGGAGTAGGSGGGGAGGGGGGGMSSA 1013
                                       ..|||.                                
Zfish   562 ---------------------------DKPNSR-------------------------------- 567

  Fly  1014 RSSPLALSSNASVSGGASVTGLTLANGAGASNGAGLPASSPYTTDFSSPSTASPFVAAAAAVAAG 1078
              .|.||:.          :|.||             |:|.|:.|             ......|
Zfish   568 --DPAALAH----------SGFTL-------------AASAYSQD-------------QLYTNGG 594

  Fly  1079 RAPSYPGYFPAVAGLGNVT----------PTDLSMKPTSGLGGNMVSNNNSNSSVTGNINSQLSA 1133
            ...|:.||    ..|||..          |||||||   .|..|..|:::|||...|        
Zfish   595 LNYSFRGY----GTLGNNLQNNGTSQTNGPTDLSMK---SLASNSTSSSSSNSHGQG-------- 644

  Fly  1134 ANLASLSNASNNNALVTATQQLQQLQQQQQQQQQQQQQQQQQQLLVAGGGGMDGQSVRAPPILPH 1198
                                                          .||||...|          
Zfish   645 ----------------------------------------------GGGGGASAQ---------- 653

  Fly  1199 KLSANEVTAARQVISAYRESAAFLLRTADQVEQLLVQQ 1236
             ||..||||.||:|:.||||||||||:||::|.|::||
Zfish   654 -LSPPEVTAVRQLIAGYRESAAFLLRSADELENLILQQ 690



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C253917236
eggNOG 1 0.900 E1_28ISH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002684
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132908
Panther 1 1.100 O PTHR12449
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5484
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.