DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG46301 and KRT9

Sequence 1:NP_001334737.1 Gene:CG46301 FlyBaseID:FBgn0283651 Length:1237 Species:Drosophila melanogaster
Sequence 2:NP_000217.2 Gene:KRT9 HGNCID:6447 Length:623 Species:Homo sapiens

Alignment Length:545 Identity:109/546 (20%)
Similarity:163/546 (30%) Gaps:217/546 (40%)


  Fly   632 GVGVGGGGGAAAGAGGGAGGAGGLLGDVVSGLGGGL-VNE----SEAYAGLMKDADKLKLM---- 687
            |.|.|.|||...|.|.|.||.||..|....|.||.| .||    .|..:.|....||::.:    
Human   114 GFGGGSGGGFGGGYGSGFGGFGGFGGGAGGGDGGILTANEKSTMQELNSRLASYLDKVQALEEAN 178

  Fly   688 ------LLAW-----------NY--------------------QNSTAV---------------- 699
                  :..|           ||                    .|.|.:                
Human   179 NDLENKIQDWYDKKGPAAIQKNYSPYYNTIDDLKDQIVDLTVGNNKTLLDIDNTRMTLDDFRIKF 243

  Fly   700 ---RNGTEGPDLSVVG-------------GLWAQYQN------ALAQN-----AAAAAAASGKMD 737
               :|..:|.|..:.|             .|..||:.      ||.:|     :......||.::
Human   244 EMEQNLRQGVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLTGQNSGDVN 308

  Fly   738 SSLSPVP----------------------RQDAHSPMETQ-----DETNSSGQKEEDEVSEDDSD 775
            ..::..|                      |:|..:..|||     .|.:||||:.:....     
Human   309 VEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQEVQSSAK----- 368

  Fly   776 DKLDEKLATTHDPERLKAFNMFVRLFVDENLDRIIPISKQPKEKIQAIIDSCARQFPEFSDRSRK 840
                |.....|..:.|:                 |.:..|..:|  |.::.....          
Human   369 ----EVTQLRHGVQELE-----------------IELQSQLSKK--AALEKSLED---------- 400

  Fly   841 RIRTYLKSCRRNKKTRDGWENTTRPTPAHLTSVQAEQILAIACENESMN---AKRMRIGLEPITH 902
               |..:.|.:.:..::...|    ..|.:|.|:.|    |.|:|:..:   :.:||:..|..|:
Human   401 ---TKNRYCGQLQMIQEQISN----LEAQITDVRQE----IECQNQEYSLLLSIKMRLEKEIETY 454

  Fly   903 AVPAPGSAVAAAAAAAAAAAVVAATSSSAGGTSTTAAGNATATCGMGGVGDATGLTSAAAAALPF 967
            .....|......::.|.... :.....|.|.....:.|.:..:.|.||.|...|           
Human   455 HNLLEGGQEDFESSGAGKIG-LGGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYG----------- 507

  Fly   968 VSAVGFARSTPNSEHADVLPFGGAGTAGGSG---------GGGAGGGGGGGMSSARSSPLALSSN 1023
                                 ||:|:.||||         |||:|||.|||.....|.    .|.
Human   508 ---------------------GGSGSRGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSG----GSG 547

  Fly  1024 ASVSGGASVTGLTLANGAGASNGAG 1048
            ...|||   :|.....|:|:..|:|
Human   548 GGHSGG---SGGNYGGGSGSGGGSG 569

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG46301NP_001334737.1 None
KRT9NP_000217.2 Head 1..152 18/38 (47%)
Filament 152..464 CDD:306535 56/361 (16%)
Coil 1A 153..188 5/35 (14%)
Linker 1 189..207 2/18 (11%)
Coil 1B 208..299 12/91 (13%)
Linker 12 300..322 3/22 (14%)
Coil 2 323..461 32/187 (17%)
Tail 462..623 35/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.