DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG46301 and Nol4l

Sequence 1:NP_001334737.1 Gene:CG46301 FlyBaseID:FBgn0283651 Length:1237 Species:Drosophila melanogaster
Sequence 2:XP_006224770.1 Gene:Nol4l RGDID:1563510 Length:586 Species:Rattus norvegicus

Alignment Length:1073 Identity:264/1074 (25%)
Similarity:342/1074 (32%) Gaps:535/1074 (50%)


  Fly   184 RKVACVEEFFDIIYNVHMELG---GRSGMHAGQKRTYRIITETYAFLPREAVTRFLTICPECKKN 245
            ::||.||:||||||::|:|..   |::..|||||:|||.|.|||||||||||||||..|.||:|.
  Rat    28 KRVAVVEDFFDIIYSMHVESSAEPGKAPKHAGQKKTYRAIAETYAFLPREAVTRFLMSCTECQKR 92

  Fly   246 LRPSSPSGGGKDSDLAGNESSSEVENYLNYSSHTESSLEAGPTAKRRRHSSAEIKASLASGLAVG 310
            :                               |..||   ||..|..     |..:.|.||:   
  Rat    93 M-------------------------------HFNSS---GPEPKEN-----EPPSPLVSGI--- 115

  Fly   311 AGVASSMSATQLDVLWTGVPRSRSPKPPMAAEAAVETTPVSVPKIRIKTQLQRPSSPQDQSPADP 375
            ......:::|.|..:...|..|:..          :.|.||.....:.......:.|...|...|
  Rat   116 IDYNMPLTSTYLKQMKLRVMNSQEQ----------DETSVSSEDFDMNDSTWMSADPHLASSLSP 170

  Fly   376 NTDAQSQSQIQSQSQSQSQSQSQSHSQPSGQGFDAQLLKSRDNLLRYYNFMRRFYAGEPVLAPPI 440
            |.:.:.:|.....||....|.|:|   .||.|                                 
  Rat   171 NQEERMRSPQNLHSQEDDDSSSES---GSGNG--------------------------------- 199

  Fly   441 YGSSLLQSLSYPTTISTAATATPTTPTTTTSAPGKMLAPPKTATPPPNPPKIKTSPDSLLRARTP 505
                             ::|..|:|.::|...|         |.|..|                 
  Rat   200 -----------------SSTLNPSTSSSTQGDP---------AFPEMN----------------- 221

  Fly   506 PVASTATSAAPKD----AAHTPINLTKSLFSSLKTGHAPSTSTPVPLKLELPSPPKPLPELRIPQ 566
                ...:|||.|    |...||||.:.                                     
  Rat   222 ----GNGAAAPMDFTASAEDQPINLCEK------------------------------------- 245

  Fly   567 LRGMPPVELSLPLPPLDLERLKPITSTYLQLTRSMGLSDEDALRFDNLETIPATPVVSTDTASVV 631
                        |||                                 .|...||...:|..   
  Rat   246 ------------LPP---------------------------------GTALGTPSYPSDGC--- 262

  Fly   632 GVGVGGGGGAAAGAGGGAGGAGGLLGDVVSGLGGGLVNESEAYAGLMKDADKLKLMLLAWNYQNS 696
                               |..||...|..|                                  
  Rat   263 -------------------GTDGLRSRVKYG---------------------------------- 274

  Fly   697 TAVRNGTEGPDLSVVGGLWAQYQNALAQNAAAAAAASGKMDS---SLSPVPRQDAHSPMETQDET 758
              |::..|.|..|                       ||..||   .:|..|          :|.|
  Rat   275 --VKSTPESPPYS-----------------------SGSYDSIKTEVSGCP----------EDLT 304

  Fly   759 NSSGQKEEDEVSEDDSDDKLD-EKLATTH--DPERLKAFNMFVRLFVDENLDRIIPISKQPKEKI 820
            .......:|:  :||.||..| :|:..:.  ||||||||||||||||||||||::||||||||||
  Rat   305 VGRAPAADDD--DDDHDDHEDNDKMNDSEGMDPERLKAFNMFVRLFVDENLDRMVPISKQPKEKI 367

  Fly   821 QAIIDSCARQFPEFSDRSRKRIRTYLKSCRRNKKTRDGWENTTRPTPAHLTSVQAEQILAIACEN 885
            ||||:||:||||||.:|:|||||||||||||.||  :|.| .|||||.||||..||.|||.|||:
  Rat   368 QAIIESCSRQFPEFQERARKRIRTYLKSCRRMKK--NGME-MTRPTPPHLTSAMAENILAAACES 429

  Fly   886 ESMN-AKRMRIGL------EPITHAVPAPGSAVAAAAAAAAAAAVVAATSSSAGGTSTTAAGNAT 943
            |:.. |||||:.:      |||......|                                    
  Rat   430 ETRKAAKRMRLEIYQSSQEEPIALDKQHP------------------------------------ 458

  Fly   944 ATCGMGGVGDATGLTSAAAAALPFVSAVGFARSTPNSEHADVLPFGGAGTAGGSGGGGAGGGGGG 1008
                    .|:|.:|.:             ..|.|.|.::.       .....:||......|.|
  Rat   459 --------RDSTAITHS-------------TYSLPASAYSQ-------DPVYVNGGLNYSYRGYG 495

  Fly  1009 GMSSARSSPLALSSNASVSGGASVTGLTLANGAGASNGAGLPASSPYTTDFSSPSTASPFVAAAA 1073
            .:||      .|..:||:..|:.            |||                           
  Rat   496 SLSS------NLQPSASLQTGSH------------SNG--------------------------- 515

  Fly  1074 AVAAGRAPSYPGYFPAVAGLGNVTPTDLSMKPTSGLGGNMVSNNNSNSSVTGNINSQLSAANLAS 1138
                                    |||||||     ||                   .|.....:
  Rat   516 ------------------------PTDLSMK-----GG-------------------ASTPTPPT 532

  Fly  1139 LSNASNNNALVTATQQLQQLQQQQQQQQQQQQQQQQQQLLVAGGGGMDGQSVRAPPILPHKLSAN 1203
            .:.:||:.:....|.|                                             ||..
  Rat   533 PTPSSNSTSRTMPTAQ---------------------------------------------LSPT 552

  Fly  1204 EVTAARQVISAYRESAAFLLRTADQVEQLLVQQ 1236
            |::|.||:|:.||||||||||:||::|.|::||
  Rat   553 EISAVRQLIAGYRESAAFLLRSADELENLILQQ 585



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28ISH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002684
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132908
Panther 1 1.100 LDO PTHR12449
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.860

Return to query results.
Submit another query.