DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG46301 and Nol4l

Sequence 1:NP_001334737.1 Gene:CG46301 FlyBaseID:FBgn0283651 Length:1237 Species:Drosophila melanogaster
Sequence 2:NP_001127772.1 Gene:Nol4l MGIID:1918765 Length:679 Species:Mus musculus

Alignment Length:1199 Identity:302/1200 (25%)
Similarity:398/1200 (33%) Gaps:562/1200 (47%)


  Fly    67 ELEQPTAEREIIYELFQPWALSTYGDQAKTKTITLRKKARILKALEG----KEHSRP---DSSKF 124
            |.|:...:.|:..: |:.|.|.||||.|||||:|..|..||.:.|:|    ...|.|   :..||
Mouse    13 ERERSPGDSELGRQ-FRDWCLRTYGDSAKTKTVTRSKYQRIAEVLQGGGGTGAGSGPAAGEKGKF 76

  Fly   125 RFWVKTKGFTTNRPEGFEEAPGSRRHLK--NLPSSAILSDNPADVDLFAASTSKGFGRRTYRKVA 187
            :|||::|||..          ||.|..|  .:....:.:.:.||    ..|..:|.   :.::||
Mouse    77 QFWVRSKGFRL----------GSGREPKMGQVVYVPVKTGSGAD----GLSEPEGI---SLKRVA 124

  Fly   188 CVEEFFDIIYNVHMELG---GRSGMHAGQKRTYRIITETYAFLPREAVTRFLTICPECKKNLRPS 249
            .||:||||||::|:|..   |::..|||||:|||.|.|||||||||||||||..|.||:|.:   
Mouse   125 VVEDFFDIIYSMHVESSAEPGKAPKHAGQKKTYRAIAETYAFLPREAVTRFLMSCTECQKRM--- 186

  Fly   250 SPSGGGKDSDLAGNESSSEVENYLNYSSHTESSLEAGPTAKRRRHSSAEIKASLASGLAVGAGVA 314
                                        |..||   ||..|..     |..:.|.||:   ....
Mouse   187 ----------------------------HFNSS---GPEPKEN-----EPPSPLVSGI---IDYN 212

  Fly   315 SSMSATQLDVLWTGVPRSRSPKPPMAAEAAVETTPVSVPKIRIKTQLQRPSSPQDQSPADPNTDA 379
            ..:::|.|..:...|..|:..          :.|.||.....:.......:.|...|...|:.:.
Mouse   213 MPLTSTYLKQMKLRVMNSQEQ----------DETSVSSEDFDMNDSAWMSADPHLASSLSPSQEE 267

  Fly   380 QSQSQIQSQSQSQSQSQSQSHSQPSGQGFDAQLLKSRDNLLRYYNFMRRFYAGEPVLAPPIYGSS 444
            :.:|.....||....|.|:|   .||.|                                     
Mouse   268 RMRSPQNLHSQEDDDSSSES---GSGNG------------------------------------- 292

  Fly   445 LLQSLSYPTTISTAATATPTTPTTTTSAPGKMLAPPKTATPPPNPPKIKTSPDSLLRARTPPVAS 509
                         ::|..|:|.::|...|         |.|..|.           .....|:..
Mouse   293 -------------SSTLNPSTSSSTQGDP---------AFPEMNG-----------NGAAAPMDF 324

  Fly   510 TATSAAPKDAAHTPINLTKSLFSSLKTGHAPSTSTPVPLKLELPSPPKPLPELRIPQLRGMPPVE 574
            |||      |...||||.:.                                             
Mouse   325 TAT------AEDQPINLCEK--------------------------------------------- 338

  Fly   575 LSLPLPPLDLERLKPITSTYLQLTRSMGLSDEDALRFDNLETIPATPVVSTDTASVVGVGVGGGG 639
                |||                                 .|...||...:|..           
Mouse   339 ----LPP---------------------------------GTALGTPSYPSDGC----------- 355

  Fly   640 GAAAGAGGGAGGAGGLLGDVVSGLGGGLVNESEAYAGLMKDADKLKLMLLAWNYQNSTAVRNGTE 704
                       |..||...|..|                                    |:|..|
Mouse   356 -----------GTDGLRSRVKYG------------------------------------VKNTPE 373

  Fly   705 GPDLSVVGGLWAQYQNALAQNAAAAAAASGKMDS---SLSPVPRQDAHSPMETQDETNSSGQKEE 766
            .|..|                       ||..||   .:|..|          :|.|.......:
Mouse   374 SPPYS-----------------------SGSYDSIKTEVSGCP----------EDLTVGRAPAAD 405

  Fly   767 DEVSEDDSDDKLD-EKLATTH--DPERLKAFNMFVRLFVDENLDRIIPISKQPKEKIQAIIDSCA 828
            |:  :||.||..| :|:..:.  ||||||||||||||||||||||::||||||||||||||:||:
Mouse   406 DD--DDDHDDHEDNDKMNDSEGMDPERLKAFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCS 468

  Fly   829 RQFPEFSDRSRKRIRTYLKSCRRNKKTRDGWENTTRPTPAHLTSVQAEQILAIACENESMN-AKR 892
            ||||||.:|:|||||||||||||.||  :|.| .|||||.||||..||.|||.|||:|:.. |||
Mouse   469 RQFPEFQERARKRIRTYLKSCRRMKK--NGME-MTRPTPPHLTSAMAENILAAACESETRKAAKR 530

  Fly   893 MRIGLEPITHAVPAPGSAVAAAAAAAAAAAVVAATSSSAGGTSTTAAGNATATCGMGGVGDATGL 957
            ||:.:                                                            
Mouse   531 MRLEI------------------------------------------------------------ 535

  Fly   958 TSAAAAALPFVSAVGFARSTPNSEHADVLPFGGAGTAGGSGGGGAGGGGGGGMSSARSSPLALSS 1022
                                                                ..|::..|:||..
Mouse   536 ----------------------------------------------------YQSSQEEPIALDK 548

  Fly  1023 NASVSGGASVTGLTLANGAGASNGAGLPASSPYTTDFSSPSTASPFVAAAAAVAAGRAPSYPGYF 1087
            ..| ....::|..|.:          ||||: |:.|             ...|..|...||.||.
Mouse   549 QHS-RDSTAITHSTYS----------LPASA-YSQD-------------PVYVNGGLNYSYRGYG 588

  Fly  1088 PAVAGL--------GNVT--PTDLSMKPTSGLGGNMVSNNNSNSSVTGNINSQLSAANLASLSNA 1142
            ...:.|        ||.:  |||||||     ||                   .|.....:.:.:
Mouse   589 SLSSNLQPSASLQTGNHSNGPTDLSMK-----GG-------------------ASTPTPPTPTPS 629

  Fly  1143 SNNNALVTATQQLQQLQQQQQQQQQQQQQQQQQQLLVAGGGGMDGQSVRAPPILPHKLSANEVTA 1207
            ||:.:....|.|                                             ||..|::|
Mouse   630 SNSTSRTMPTAQ---------------------------------------------LSPTEISA 649

  Fly  1208 ARQVISAYRESAAFLLRTADQVEQLLVQQ 1236
            .||:|:.||||||||||:||::|.|::||
Mouse   650 VRQLIAGYRESAAFLLRSADELENLILQQ 678



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28ISH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3532
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002684
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132908
Panther 1 1.100 LDO PTHR12449
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5484
TreeFam 1 0.960
76.940

Return to query results.
Submit another query.