DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG46301 and Nol4

Sequence 1:NP_001334737.1 Gene:CG46301 FlyBaseID:FBgn0283651 Length:1237 Species:Drosophila melanogaster
Sequence 2:NP_001334438.1 Gene:Nol4 MGIID:2441684 Length:637 Species:Mus musculus

Alignment Length:1178 Identity:288/1179 (24%)
Similarity:402/1179 (34%) Gaps:558/1179 (47%)


  Fly    73 AEREIIYELFQPWALSTYGDQAKTKTITLRKKARILKALEGKEHSRPDSSKFRFWVKTKGFTTNR 137
            :||: :|..||.|.|.||||..||||:|.:|..||::.|.|.|.|..|::||:||||:|||...:
Mouse     3 SERD-MYRQFQDWCLRTYGDSGKTKTVTRKKYERIVQLLNGSESSSTDNAKFKFWVKSKGFQLGQ 66

  Fly   138 PEGFEEAPGSRRHLKNLPSSAILSDNPADVDLFA-ASTSKGFG---RRTYRKVACVEEFFDIIYN 198
            |:......|..:.:                 ||. ..|:.|.|   :.:.|:||.||:||||||:
Mouse    67 PDEVRGGGGGAKQV-----------------LFVRVKTTDGVGVDEKLSLRRVAVVEDFFDIIYS 114

  Fly   199 VHMELGGRSGM---HAGQKRTYRIITETYAFLPREAVTRFLTICPECKKNLRPSSPSGGGKDSDL 260
            :|:|.|.....   ||||||||:.|:|:|||||||||||||..|.||:|.:. .:|.|       
Mouse   115 MHVETGPNGEQIRKHAGQKRTYKAISESYAFLPREAVTRFLMSCSECQKRMH-LNPDG------- 171

  Fly   261 AGNESSSEVENYLNYSSHTESSLEAGPTAKRRRHSSAEIKASLASGLAVGAGVASSMSATQLDVL 325
                           :.|.::.                                           
Mouse   172 ---------------TDHKDNG------------------------------------------- 178

  Fly   326 WTGVPRSRSPKPPMAAEAAVE-TTPVSVPKIR-IKTQLQRPSSPQDQSPADPN----TDAQSQSQ 384
                      |||....:.:: ..|:::..:: :|.||......:|:|..:.:    :|:...|.
Mouse   179 ----------KPPTLVTSMIDYNMPITMAYMKHMKLQLLNSQQDEDESSIESDEFDMSDSTRMSA 233

  Fly   385 IQSQSQSQSQSQSQSHSQPSGQGFDAQLLKSRDNLLRYYNFMRRFYAGEPVLAPPIYGSSLLQSL 449
            :.|...|..:.:.||.....||..|....:|                           |:..::|
Mouse   234 VNSDLSSNLEERMQSPQTVHGQQDDDSAAES---------------------------SNGNETL 271

  Fly   450 SYPTTISTAATATPTTPTTTTSAPGKMLAPPKTATPPPNPPKIKTSPDSLLRARTPPVASTATSA 514
            .:    |:||:.         .|.|:                             .|..|::...
Mouse   272 GH----SSAASG---------GAHGR-----------------------------EPEDSSSDGK 294

  Fly   515 APKDAAHTPINLTKSLFSSLKTGHAPSTSTPVPLKLELPSPPKPLPELRIPQLRGMPPVELSLPL 579
            ...:....|:||:.|          ||::                                    
Mouse   295 TGLEQEEQPLNLSDS----------PSSA------------------------------------ 313

  Fly   580 PPLDLERLKPITSTYLQLTRSMGLSDEDALRFDNLETIPATPVVSTDTASVVGVGVGGGGGAAAG 644
                            |||....:.|:                                      
Mouse   314 ----------------QLTSEFRIDDQ-------------------------------------- 324

  Fly   645 AGGGAGGAGGLLGDVVSGLGGGLVNESEAYAGLMKDADKLKLMLLAWNYQNSTAVRNGTEGPDLS 709
                  |:.|                          .:|.|.:|::.......|..||::.|..|
Mouse   325 ------GSDG--------------------------KNKYKNLLISDLKMEREARENGSKSPAHS 357

  Fly   710 VVGGLWAQYQNALAQNAAAAAAASGKMDSSLSPVPRQDAHSPMETQDETNSSGQKEEDEVSEDDS 774
                 ::.|.             |||.:|    |.|       ..:|.:.:.|.::|||..|.:.
Mouse   358 -----YSSYD-------------SGKNES----VDR-------GAEDLSLNRGDEDEDEHDEHED 393

  Fly   775 DDKLDEKLATTHDPERLKAFNMFVRLFVDENLDRIIPISKQPKEKIQAIIDSCARQFPEFSDRSR 839
            .:|::|....  :.||||||||||||||||||||::|||||||||||||||||.|||||:.:|:|
Mouse   394 SEKVNETDGV--EAERLKAFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQERAR 456

  Fly   840 KRIRTYLKSCRRNKKTRDGWENTTRPTPAHLTSVQAEQILAIACENESMN-AKRMRIGLEPITHA 903
            ||||||||||||.|  |.|:| .:||.|:||||..||.|||.|||:||.| |||||:. :....|
Mouse   457 KRIRTYLKSCRRMK--RSGFE-MSRPIPSHLTSAVAESILASACESESRNAAKRMRLD-KAQDEA 517

  Fly   904 VPAPGSAVAAAAAAAAAAAVVAATSSSAGGTSTTAAGNATATCGMGGVGDATGLTSAAAAALPFV 968
            .||.......||.|..:.|.|                                            
Mouse   518 APADKQCKPEAAQATYSTATV-------------------------------------------- 538

  Fly   969 SAVGFARSTPNSEHADVLPFGGAGTAGGSGGGGAGGGGGGGMSSARSSPLALSSNASVSGGASVT 1033
                     |.|:  :||...|.||.......|.||              .||.:.:.|.|    
Mouse   539 ---------PGSQ--EVLYINGNGTYSYHSYRGLGG--------------LLSLDDTSSSG---- 574

  Fly  1034 GLTLANGAGASNGAGLPASSPYTTDFSSPSTASPFVAAAAAVAAGRAPSYPGYFPAVAGLGNVTP 1098
                                                                            |
Mouse   575 ----------------------------------------------------------------P 575

  Fly  1099 TDLSMKPTSGLGGNMVSNNNSNSSVTGNINSQLSAANLASLSNASNNNALVTATQQLQQLQQQQQ 1163
            ||||||                                                           
Mouse   576 TDLSMK----------------------------------------------------------- 581

  Fly  1164 QQQQQQQQQQQQQLLVAGGGGMDGQSVRAPPILPHKLSANEVTAARQVISAYRESAAFLLRTADQ 1228
                       :||  |.|.|....|...|     :||..|:.|.||:::.||||||||||:||:
Mouse   582 -----------RQL--ATGSGSSSSSTSRP-----QLSPTEINAVRQLVAGYRESAAFLLRSADE 628

  Fly  1229 VEQLLVQQ 1236
            :|.|::||
Mouse   629 LENLILQQ 636



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28ISH
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002684
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132908
Panther 1 1.100 O PTHR12449
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5484
TreeFam 1 0.960
76.890

Return to query results.
Submit another query.