DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG46301 and Nol4

Sequence 1:NP_001334737.1 Gene:CG46301 FlyBaseID:FBgn0283651 Length:1237 Species:Drosophila melanogaster
Sequence 2:XP_006254515.1 Gene:Nol4 RGDID:1310663 Length:638 Species:Rattus norvegicus

Alignment Length:1178 Identity:286/1179 (24%)
Similarity:396/1179 (34%) Gaps:557/1179 (47%)


  Fly    73 AEREIIYELFQPWALSTYGDQAKTKTITLRKKARILKALEGKEHSRPDSSKFRFWVKTKGFTTNR 137
            :||: :|..||.|.|.||||..||||:|.:|..||::.|.|.|.|..|::||:||||:|||...:
  Rat     3 SERD-MYRQFQDWCLRTYGDSGKTKTVTRKKYERIVQLLNGSESSSTDNAKFKFWVKSKGFQLGQ 66

  Fly   138 PEGFEEAPGSRRHLKNLPSSAILSDNPADVDLFA-ASTSKGFG---RRTYRKVACVEEFFDIIYN 198
            |:......|..:.:                 ||. ..|:.|.|   :.:.|:||.||:||||||:
  Rat    67 PDEVRGGGGGAKQV-----------------LFVRVKTTDGVGVDEKLSLRRVAVVEDFFDIIYS 114

  Fly   199 VHMELGGRSGM---HAGQKRTYRIITETYAFLPREAVTRFLTICPECKKNLRPSSPSGGGKDSDL 260
            :|:|.|.....   ||||||||:.|:|:|||||||||||||..|.||:|.:. .:|.|       
  Rat   115 MHVETGPNGEQIRKHAGQKRTYKAISESYAFLPREAVTRFLMSCSECQKRMH-LNPDG------- 171

  Fly   261 AGNESSSEVENYLNYSSHTESSLEAGPTAKRRRHSSAEIKASLASGLAVGAGVASSMSATQLDVL 325
                           :.|.::.                                           
  Rat   172 ---------------TDHKDNG------------------------------------------- 178

  Fly   326 WTGVPRSRSPKPPMAAEAAVE-TTPVSVPKIR-IKTQLQRPSSPQDQSPADPN----TDAQSQSQ 384
                      |||....:.:: ..|:::..:: :|.||......:|:|..:.:    :|:...|.
  Rat   179 ----------KPPTLVTSMIDYNMPITMAYMKHMKLQLLNSQQDEDESSIESDEFDMSDSTRMSA 233

  Fly   385 IQSQSQSQSQSQSQSHSQPSGQGFDAQLLKSRDNLLRYYNFMRRFYAGEPVLAPPIYGSSLLQSL 449
            :.|...|..:.:.||.....||..|....:|                           |:..::|
  Rat   234 VNSDLSSNLEERVQSPQTAQGQQDDDSAAES---------------------------SNGNETL 271

  Fly   450 SYPTTISTAATATPTTPTTTTSAPGKMLAPPKTATPPPNPPKIKTSPDSLLRARTPPVASTATSA 514
            .:.:..|..|..         ..||...:..||..                              
  Rat   272 GHSSVASGGAHG---------REPGDSSSDGKTGL------------------------------ 297

  Fly   515 APKDAAHTPINLTKSLFSSLKTGHAPSTSTPVPLKLELPSPPKPLPELRIPQLRGMPPVELSLPL 579
               :....|:||:.|..|:                                              
  Rat   298 ---EQEEQPLNLSDSPRSA---------------------------------------------- 313

  Fly   580 PPLDLERLKPITSTYLQLTRSMGLSDEDALRFDNLETIPATPVVSTDTASVVGVGVGGGGGAAAG 644
                            |||....:.|:                                      
  Rat   314 ----------------QLTSEYRVEDQ-------------------------------------- 324

  Fly   645 AGGGAGGAGGLLGDVVSGLGGGLVNESEAYAGLMKDADKLKLMLLAWNYQNSTAVRNGTEGPDLS 709
                  |:.|                          .:|.|.:|::.......|..||::.|..|
  Rat   325 ------GSNG--------------------------KNKYKNLLISDLKMEREARENGSKSPAHS 357

  Fly   710 VVGGLWAQYQNALAQNAAAAAAASGKMDSSLSPVPRQDAHSPMETQDETNSSGQKEEDEVSEDDS 774
                 ::.|.             |||.:.    |.|       ..:|.:.|.|.::|||..|.:.
  Rat   358 -----YSSYD-------------SGKNEG----VDR-------GAEDLSLSRGDEDEDEHDEHED 393

  Fly   775 DDKLDEKLATTHDPERLKAFNMFVRLFVDENLDRIIPISKQPKEKIQAIIDSCARQFPEFSDRSR 839
            .:|::|....  :.||||||||||||||||||||::|||||||||||||||||.|||||:.:|:|
  Rat   394 SEKVNESDGV--EAERLKAFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQERAR 456

  Fly   840 KRIRTYLKSCRRNKKTRDGWENTTRPTPAHLTSVQAEQILAIACENESMN-AKRMRIGLEPITHA 903
            ||||||||||||.|  |.|:| .:||.|:||||..||.|||.|||:||.| |||||:. :....|
  Rat   457 KRIRTYLKSCRRMK--RSGFE-MSRPIPSHLTSAVAESILASACESESRNAAKRMRLD-KTQDEA 517

  Fly   904 VPAPGSAVAAAAAAAAAAAVVAATSSSAGGTSTTAAGNATATCGMGGVGDATGLTSAAAAALPFV 968
            .||.......||.|..:.:.|                                            
  Rat   518 TPADKQCKPEAAQATYSTSTV-------------------------------------------- 538

  Fly   969 SAVGFARSTPNSEHADVLPFGGAGTAGGSGGGGAGGGGGGGMSSARSSPLALSSNASVSGGASVT 1033
                     |.|:  :||...|.||.......|.|||             .|:.|.:.|.|    
  Rat   539 ---------PGSQ--EVLYINGNGTYSYHSYRGLGGG-------------LLNLNDTSSSG---- 575

  Fly  1034 GLTLANGAGASNGAGLPASSPYTTDFSSPSTASPFVAAAAAVAAGRAPSYPGYFPAVAGLGNVTP 1098
                                                                            |
  Rat   576 ----------------------------------------------------------------P 576

  Fly  1099 TDLSMKPTSGLGGNMVSNNNSNSSVTGNINSQLSAANLASLSNASNNNALVTATQQLQQLQQQQQ 1163
            ||||||                                                           
  Rat   577 TDLSMK----------------------------------------------------------- 582

  Fly  1164 QQQQQQQQQQQQQLLVAGGGGMDGQSVRAPPILPHKLSANEVTAARQVISAYRESAAFLLRTADQ 1228
                       :||  |.|.|....|...|     :||..|:.|.||:::.||||||||||:||:
  Rat   583 -----------RQL--APGSGSSSSSNPRP-----QLSPTEINAVRQLVAGYRESAAFLLRSADE 629

  Fly  1229 VEQLLVQQ 1236
            :|.|::||
  Rat   630 LENLILQQ 637



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28ISH
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002684
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132908
Panther 1 1.100 O PTHR12449
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.860

Return to query results.
Submit another query.