DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG46301 and NOL4L

Sequence 1:NP_001334737.1 Gene:CG46301 FlyBaseID:FBgn0283651 Length:1237 Species:Drosophila melanogaster
Sequence 2:NP_001243727.1 Gene:NOL4L HGNCID:16106 Length:680 Species:Homo sapiens

Alignment Length:1197 Identity:299/1198 (25%)
Similarity:407/1198 (34%) Gaps:557/1198 (46%)


  Fly    67 ELEQPTAEREIIYELFQPWALSTYGDQAKTKTITLRKKARILKALEG----KEHSRP---DSSKF 124
            |.|:...:.|:..: |:.|.|.||||.|||||:|..|..||.:.|:|    ...|.|   :..||
Human    13 ERERSPGDSELGRQ-FRDWCLRTYGDSAKTKTVTRSKYQRIAEVLQGGGGTGAGSGPAAGEKGKF 76

  Fly   125 RFWVKTKGFTTNRPEGFEEAPGSRRHLK--NLPSSAILSDNPADVDLFAASTSKGFGRRTYRKVA 187
            :|||::|||..          ||.|..|  .:....:.:.:.||    ..|..:|.   :.::||
Human    77 QFWVRSKGFRL----------GSGREPKMGQVVYVPVKTGSGAD----GLSEPEGI---SLKRVA 124

  Fly   188 CVEEFFDIIYNVHMELG---GRSGMHAGQKRTYRIITETYAFLPREAVTRFLTICPECKKNLRPS 249
            .||:||||||::|:|..   |::..|||||:|||.|.|||||||||||||||..|.||:|.:..:
Human   125 VVEDFFDIIYSMHVESSAEPGKAPKHAGQKKTYRAIAETYAFLPREAVTRFLMSCTECQKRMHFN 189

  Fly   250 SPSGGGKDSDLAGNESSSE-VENYLNYSSHTESSLEAGPTAKRRRHSSAEIKASLASGLAVGAGV 313
            |.....|:     ||..|. |...::|:                                     
Human   190 SNGLEPKE-----NEPPSPLVSGIIDYN------------------------------------- 212

  Fly   314 ASSMSATQLDVLWTGVPRSRSPKPPMAAEAAVETTPVSVPKIRIKTQLQRPSSPQDQSPADPNTD 378
             ..:::|.|..:...|..|:..          :.|.||.....:.......:.|...|...|:.|
Human   213 -MPLTSTYLKQMKLRVMNSQEQ----------DETSVSSEDFDMSDSTWMSADPHLASSLSPSQD 266

  Fly   379 AQSQSQIQSQSQSQSQSQSQSHSQPSGQGFDAQLLKSRDNLLRYYNFMRRFYAGEPVLAPPIYGS 443
            .:.:|.....||....|.|:|   .||.|                                    
Human   267 ERMRSPQNLHSQEDDDSSSES---GSGNG------------------------------------ 292

  Fly   444 SLLQSLSYPTTISTAATATPTTPTTTTSAPGKMLAPPKTATPPPNPPKIKTSPDSLLRARTPPVA 508
                          ::|..|:|.::|...|         |.|..|                    
Human   293 --------------SSTLNPSTSSSTQGDP---------AFPEMN-------------------- 314

  Fly   509 STATSAAPKDAAHTPINLTKSLFSSLKTGHAPSTSTPVPLKLELPSPPKPLPELRIPQLRGMPPV 573
                    .:.|..|::.|.:           :...|:.|..:||                    
Human   315 --------GNGAVAPMDFTTA-----------AEDQPINLCDKLP-------------------- 340

  Fly   574 ELSLPLPPLDLERLKPITSTYLQLTRSMGLSDEDALRFDNLETIPATPVVSTDTASVVGVGVGGG 638
                                                        |||.:                
Human   341 --------------------------------------------PATAL---------------- 345

  Fly   639 GGAAAGAGGGAGGAGGLLGDVVSGLGGGLVNESEAYAGLMKDADKLKLMLLAWNYQNSTAVRNGT 703
             |.|:....|. ||.||...|..|                                    |:...
Human   346 -GTASYPSDGC-GADGLRSRVKYG------------------------------------VKTTP 372

  Fly   704 EGPDLSVVGGLWAQYQNALAQNAAAAAAASGKMDS---SLSPVPRQDAHSPMETQDETNSSGQKE 765
            |.|..|                       ||..||   .:|..|.........|.|:       :
Human   373 ESPPYS-----------------------SGSYDSIKTEVSGCPEDLTVGRAPTADD-------D 407

  Fly   766 EDEVSEDDSDDKLDEKLATTHDPERLKAFNMFVRLFVDENLDRIIPISKQPKEKIQAIIDSCARQ 830
            :|:..:.:.:||:::  :...||||||||||||||||||||||::||||||||||||||:||:||
Human   408 DDDHDDHEDNDKMND--SEGMDPERLKAFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQ 470

  Fly   831 FPEFSDRSRKRIRTYLKSCRRNKKTRDGWENTTRPTPAHLTSVQAEQILAIACENESMN-AKRMR 894
            ||||.:|:|||||||||||||.||  :|.| .|||||.||||..||.|||.|||:|:.. |||||
Human   471 FPEFQERARKRIRTYLKSCRRMKK--NGME-MTRPTPPHLTSAMAENILAAACESETRKAAKRMR 532

  Fly   895 IGLEPITHAVPAPGSAVAAAAAAAAAAAVVAATSSSAGGTSTTAAGNATATCGMGGVGDATGLTS 959
            :.:                                                              
Human   533 LEI-------------------------------------------------------------- 535

  Fly   960 AAAAALPFVSAVGFARSTPNSEHADVLPFGGAGTAGGSGGGGAGGGGGGGMSSARSSPLALSSNA 1024
                                                              ..|::..|:||....
Human   536 --------------------------------------------------YQSSQDEPIALDKQH 550

  Fly  1025 SVSGGASVTGLTLANGAGASNGAGLPASSPYTTDFSSPSTASPFVAAAAAVAAGRAPSYPGYF-- 1087
            | ...|::|..|.:          ||||| |:.|   |..|:          .|...||.||.  
Human   551 S-RDSAAITHSTYS----------LPASS-YSQD---PVYAN----------GGLNYSYRGYGAL 590

  Fly  1088 ------PAVAGLGNVT--PTDLSMKPTSGLGGNMVSNNNSNSSVTGNINSQLSAANLASLSNASN 1144
                  ||....||.:  |||||||     ||         :|.|       |.....:.|:.|.
Human   591 SSNLQPPASLQTGNHSNGPTDLSMK-----GG---------ASTT-------STTPTPTPSSTST 634

  Fly  1145 NNALVTATQQLQQLQQQQQQQQQQQQQQQQQQLLVAGGGGMDGQSVRAPPILPHKLSANEVTAAR 1209
            :..:.||                                               :||..|::|.|
Human   635 SRPVPTA-----------------------------------------------QLSPTEISAVR 652

  Fly  1210 QVISAYRESAAFLLRTADQVEQLLVQQ 1236
            |:|:.||||||||||:||::|.|::||
Human   653 QLIAGYRESAAFLLRSADELENLILQQ 679



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28ISH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3485
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002684
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132908
Panther 1 1.100 LDO PTHR12449
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5484
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.