DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG46301 and nol4

Sequence 1:NP_001334737.1 Gene:CG46301 FlyBaseID:FBgn0283651 Length:1237 Species:Drosophila melanogaster
Sequence 2:XP_002934174.2 Gene:nol4 XenbaseID:XB-GENE-6037484 Length:524 Species:Xenopus tropicalis

Alignment Length:1053 Identity:241/1054 (23%)
Similarity:318/1054 (30%) Gaps:545/1054 (52%)


  Fly   199 VHMELGGRSGM---HAGQKRTYRIITETYAFLPREAVTRFLTICPECKKNLRPSSPSGGGKDSDL 260
            :|:|.|.....   ||||||||:.|:|||||||||||||||..|.||:|.:. .:|.||      
 Frog     1 MHVETGPNGEQIRKHAGQKRTYKAISETYAFLPREAVTRFLMSCSECQKRMH-LNPDGG------ 58

  Fly   261 AGNESSSEVENYLNYSSHTESSLEAGPTAKRRRHSSAEIKASLASGLAVGAGVASSMSATQLDVL 325
                            .|.::.                                           
 Frog    59 ----------------EHKDNG------------------------------------------- 64

  Fly   326 WTGVPRSRSPKPPMAAEAAVE-TTPVSVPKIR-IKTQLQRPSSPQDQSPADPN----TDAQSQSQ 384
                      |||....:.:: ..|:::..:: :|.||......:|:|..:.:    :|:...|.
 Frog    65 ----------KPPTLVTSMIDYNMPITMAYMKHMKLQLLNSQQDEDESSIESDEFDMSDSTRMSA 119

  Fly   385 IQSQSQSQSQSQSQSHSQPSGQGFDAQLLKSRDNLLRYYNFMRRFYAGEPVLAPPIYGSSLLQSL 449
            :.|...|..:.:.||.....||..|                                 .|..:|.
 Frog   120 VNSDLSSNLEERMQSPQNLQGQQDD---------------------------------DSAAESY 151

  Fly   450 SYPTTISTAATATPTTPTTTTSAPGKMLAPPKTATPPPNPPKIKTSPDSLLRARTPPVASTATSA 514
            :...|:..|:.:|..|                                   ..|......|....
 Frog   152 TCNETVGQASNSTGAT-----------------------------------HNREMMEVITTNGN 181

  Fly   515 APKDAAHTPINLTKSLFSSLKTGHAPSTSTPVPLKLELPSPPKPLPELRIP--QLRGMPPVELSL 577
            |..:....|:||               :..||..:|.        ||.||.  ...|..|     
 Frog   182 AISEQEEQPLNL---------------SDCPVSSQLN--------PEYRIDDHSSNGKHP----- 218

  Fly   578 PLPPLDLERLKPITSTYLQLTRSMGLSDEDALRFDNLETIPATPVVSTDTASVVGVGVGGGGGAA 642
                                             :.||                            
 Frog   219 ---------------------------------YKNL---------------------------- 222

  Fly   643 AGAGGGAGGAGGLLGDVVSGLGGGLVNESEAYAGLMKDADKLKLMLLAWNYQNSTAVRNGTEGPD 707
                        |:||                         ||:        :..|..||.:.|.
 Frog   223 ------------LIGD-------------------------LKM--------DREARENGNKSPA 242

  Fly   708 LSVVGGLWAQYQNALAQNAAAAAAASGKMDSSLSPVPRQDAHSPMETQDETNSSGQKEEDEVSED 772
            .|     ::.|.             |||.:|             :....|..|..:.:||   ||
 Frog   243 HS-----YSSYD-------------SGKNES-------------VGGCGEDLSMTRGDED---ED 273

  Fly   773 DSDDKLDEKLATTHD---PERLKAFNMFVRLFVDENLDRIIPISKQPKEKIQAIIDSCARQFPEF 834
            |.||..|.:.|...|   .||||||||||||||||||||::|||||||||||||||||.|||||:
 Frog   274 DHDDHEDAEKAAESDGVEAERLKAFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEY 338

  Fly   835 SDRSRKRIRTYLKSCRRNKKTRDGWENTTRPTPAHLTSVQAEQILAIACENESMN-AKRMRIGLE 898
            .:|:|||||||||||||.|  |.|:| .:||.|:||||..||.|||.|||:||.| |||||:..:
 Frog   339 QERARKRIRTYLKSCRRMK--RSGFE-MSRPIPSHLTSAVAETILASACESESRNAAKRMRLDRQ 400

  Fly   899 PITHAVPAPGSAVAAAAAAAAAAAVVAATSSSAGGTSTTAAGNATATCGMGGVGDATGLTSAAAA 963
            ..|  .||..|.....|....:.:.|::|.                                   
 Frog   401 DET--PPADKSHKQDTAQVTYSTSAVSSTQ----------------------------------- 428

  Fly   964 ALPFVSAVGFARSTPNSEHADVLPFGGAGTAGGSGGGGAGGGGGGGMSSARSSPLALSSNASVSG 1028
                                |||...|.||.......|.|||                       
 Frog   429 --------------------DVLYINGNGTYSYHTYRGLGGG----------------------- 450

  Fly  1029 GASVTGLTLANGAGASNGAGLPASSPYTTDFSSPSTASPFVAAAAAVAAGRAPSYPGYFPAVAGL 1093
                    |.|.:..||..                                              
 Frog   451 --------LLNLSDTSNSG---------------------------------------------- 461

  Fly  1094 GNVTPTDLSMKPTSGLGGNMVSNNNSNSSVTGNINSQLSAANLASLSNASNNNALVTATQQLQQL 1158
                |||||||                         :..|.:..|.||.||..            
 Frog   462 ----PTDLSMK-------------------------RPLATSSTSPSNTSNRT------------ 485

  Fly  1159 QQQQQQQQQQQQQQQQQQLLVAGGGGMDGQSVRAPPILPHKLSANEVTAARQVISAYRESAAFLL 1223
                                                    :|:..|:.|.||:::.|||||||||
 Frog   486 ----------------------------------------QLNPTEINAVRQLVAGYRESAAFLL 510

  Fly  1224 RTADQVEQLLVQQ 1236
            |:||::|.|::||
 Frog   511 RSADELENLILQQ 523



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28ISH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002684
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.