DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG46301 and nol4l

Sequence 1:NP_001334737.1 Gene:CG46301 FlyBaseID:FBgn0283651 Length:1237 Species:Drosophila melanogaster
Sequence 2:XP_002939700.1 Gene:nol4l XenbaseID:XB-GENE-962007 Length:405 Species:Xenopus tropicalis

Alignment Length:580 Identity:174/581 (30%)
Similarity:211/581 (36%) Gaps:267/581 (46%)


  Fly   696 STAVRNGTEGPDLSVVGGLWAQYQNALAQNAAA----AAAASGKMDSSLSPVP------------ 744
            |.|.|:|:. ||::      ....|:|.:.:|.    ....|.||.|||...|            
 Frog    53 SNAARDGSL-PDIN------GNSTNSLLELSATPEDQPMNLSDKMRSSLGVPPYTPDNDALRNRG 110

  Fly   745 ----RQDAHSPMETQD-----ETNSSGQKEEDEVS------EDDSDDKLDEKLATTH---DPERL 791
                :..:.||..:..     :|..||..|:..||      :||.||..|....|..   |||||
 Frog   111 KYTLKATSESPPYSSGSYDSVKTEVSGCAEDLSVSRTPAGEDDDDDDHEDNDRITDSEGLDPERL 175

  Fly   792 KAFNMFVRLFVDENLDRIIPISKQPKEKIQAIIDSCARQFPEFSDRSRKRIRTYLKSCRRNKKTR 856
            |||||||||||||||||::||||||||||||||:||:||||||.:|:|||||||||||||.||  
 Frog   176 KAFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQERARKRIRTYLKSCRRMKK-- 238

  Fly   857 DGWENTTRPTPAHLTSVQAEQILAIACENESMN-AKRMRIGLEPITHAVPAPGSAVAAAAAAAAA 920
            :|.| ..||||.||||..||.|||.|||:||.. |||||:                         
 Frog   239 NGME-MARPTPPHLTSAMAENILAAACESESRKAAKRMRL------------------------- 277

  Fly   921 AAVVAATSSSAGGTSTTAAGNATATCGMGGVGDATGLTSAAAAALPFVSAVGFARSTPNSEHADV 985
             .|..|:....                  .:...||.|                           
 Frog   278 -EVYQASQDDI------------------SLEKPTGTT--------------------------- 296

  Fly   986 LPFGGAGTAGGSGGGGAGGGGGGGMSSARSSPLALSSNASVSGGASVTGLTLANGAGASNGAGLP 1050
                                         .||.:|.|.........:.|                
 Frog   297 -----------------------------QSPYSLPSGTYTQDPVYMNG---------------- 316

  Fly  1051 ASSPYTTDFSSPSTASPFVAAAAAVAAGRAPSYPGYFPAVAGL--GNVT--PTDLSMKPTSGLGG 1111
             |..|                          ||.||..|.|.|  ||..  |||||||   ||  
 Frog   317 -SLHY--------------------------SYRGYGTAPASLPTGNHCNGPTDLSMK---GL-- 349

  Fly  1112 NMVSNNNSNSSVTGNINSQLSAANLASLSNASNNNALVTATQQLQQLQQQQQQQQQQQQQQQQQQ 1176
                       .||:             ::.|..|.....||                       
 Frog   350 -----------ATGS-------------AHPSGTNRAAPCTQ----------------------- 367

  Fly  1177 LLVAGGGGMDGQSVRAPPILPHKLSANEVTAARQVISAYRESAAFLLRTADQVEQLLVQQ 1236
                                   ||..|:.|.||:|:.||||||||||:||::|.|::||
 Frog   368 -----------------------LSPTEIGAVRQLIAGYRESAAFLLRSADELENLILQQ 404



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28ISH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002684
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.