DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18095 and kera

Sequence 1:NP_001188805.1 Gene:CG18095 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001020719.1 Gene:kera ZFINID:ZDB-GENE-041210-165 Length:348 Species:Danio rerio

Alignment Length:270 Identity:76/271 (28%)
Similarity:127/271 (47%) Gaps:38/271 (14%)


  Fly   116 LDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQ--IENDSFDGLSHLKHLYLNGNQLAHIDGSF 178
            |.|.:|::..||..:.....||:.::|..|:|:.  :|.|:...:|:|.|||:..|.|:.|....
Zfish    75 LYLQNNLIDVLSANALRNATQLKWINLNRNKITTEGLEVDALRAMSNLVHLYMEDNLLSSIPSPL 139

  Fly   179 FRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLL--SSLQFLSQRGLARLVHLNLSSN 241
               ..:|..|.|..|:|..|....|....||..|.|..|.|  .::..:|.:||..|:.:||:.|
Zfish   140 ---PAKLEQLRLSRNKISKIPPGVFSGMGHLTLLDLQSNKLQDDAVTEVSLKGLNNLIQINLAKN 201

  Fly   242 LLQKLE---PFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYD----ESL 299
            .|..:.   |...::.|      |..|||.|:..|...||..:..|.::.|   |:.:    :::
Zfish   202 QLNSMPLGLPPTTTQIF------LDGNNIEKIPAEYFKGLPKVASLRLNRN---KLANGGIPKNV 257

  Fly   300 DSLIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISS-----------QMMFNQNHL 353
            .:|.::|.|.:|.|.||.:|    ..::.||.:.|.:|||:.::|           .:......|
Zfish   258 FNLSSILDLQLSHNQLTEVP----VISSGLEHLHLDHNKIKSVNSSDICPPGVLDDHLEEKSPRL 318

  Fly   354 RYIKLSGNAI 363
            ||::|.||.|
Zfish   319 RYLRLDGNEI 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566 3/7 (43%)
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..136 CDD:275380 5/20 (25%)
LRR_RI 115..384 CDD:238064 76/271 (28%)
LRR_8 135..195 CDD:290566 19/62 (31%)
leucine-rich repeat 137..160 CDD:275380 7/25 (28%)
leucine-rich repeat 161..184 CDD:275380 7/23 (30%)
LRR_8 184..243 CDD:290566 20/61 (33%)
leucine-rich repeat 185..208 CDD:275380 7/23 (30%)
leucine-rich repeat 209..232 CDD:275380 8/25 (32%)
LRR_8 232..289 CDD:290566 16/60 (27%)
leucine-rich repeat 233..256 CDD:275380 7/26 (27%)
leucine-rich repeat 257..280 CDD:275380 8/23 (35%)
LRR_8 280..339 CDD:290566 16/63 (25%)
leucine-rich repeat 281..304 CDD:275380 4/27 (15%)
leucine-rich repeat 305..328 CDD:275380 7/23 (30%)
keraNP_001020719.1 NEL <28..>165 CDD:330839 27/93 (29%)
LRR 1. {ECO:0000255} 70..92 5/17 (29%)
leucine-rich repeat 72..95 CDD:275380 5/20 (25%)
LRR 2. {ECO:0000255} 93..118 7/25 (28%)
leucine-rich repeat 96..121 CDD:275380 7/25 (28%)
NEL <105..>291 CDD:330839 56/202 (28%)
LRR 3. {ECO:0000255} 119..140 8/24 (33%)
leucine-rich repeat 122..142 CDD:275380 7/23 (30%)
LRR 4. {ECO:0000255} 141..163 7/22 (32%)
leucine-rich repeat 143..166 CDD:275380 7/23 (30%)
LRR 5. {ECO:0000255} 165..189 7/24 (29%)
leucine-rich repeat 167..192 CDD:275380 8/25 (32%)
LRR 6. {ECO:0000255} 190..213 7/23 (30%)
leucine-rich repeat 193..216 CDD:275380 6/23 (26%)
LRR 7. {ECO:0000255} 215..234 7/25 (28%)
leucine-rich repeat 217..237 CDD:275380 9/26 (35%)
LRR 8. {ECO:0000255} 235..260 4/28 (14%)
leucine-rich repeat 238..262 CDD:275380 4/27 (15%)
LRR 9. {ECO:0000255} 262..280 7/22 (32%)
LRR_8 266..328 CDD:316378 19/66 (29%)
LRR 10. {ECO:0000255} 281..303 7/22 (32%)
leucine-rich repeat 318..339 CDD:275380 7/12 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45712
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.