DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rk and RLP38

Sequence 1:NP_476702.1 Gene:rk FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_188953.1 Gene:RLP38 AraportID:AT3G23120 Length:784 Species:Arabidopsis thaliana

Alignment Length:726 Identity:153/727 (21%)
Similarity:242/727 (33%) Gaps:263/727 (36%)


  Fly   210 LSDNSIINMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHL 274
            ||..|......:|.:.|..|..|.|.||.|:...|.|.:.|:.||.|.|:.|.||......:|:|
plant    93 LSTASTSLKSSSALFKLQHLTHLDLSNCNLQGEIPSSIENLSHLTHLDLSTNHLVGEVPASIGNL 157

  Fly   275 QKLRTLRLEGN-LFYRIPTN----------------------ALAGLRTLEALNLGS-------- 308
            .:|..:.|.|| |...|||:                      .|:.|.:|..|:|.|        
plant   158 NQLEYIDLRGNHLRGNIPTSFANLTKLSLLDLHENNFTGGDIVLSNLTSLAILDLSSNHFKSFFS 222

  Fly   309 -------NLLTIINDED-----FP----RMPNLIVLLLKRNQIM-KISAGALKNLTALKVLELD- 355
                   ||..|..:|:     ||    ::.:|..:.|.:||.. .|..|...:.:.|.:|::. 
plant   223 ADLSGLHNLEQIFGNENSFVGLFPASLLKISSLDKIQLSQNQFEGPIDFGNTSSSSRLTMLDISH 287

  Fly   356 DNLISSLPEGLSKLSQLQELSITSNRLR---------WINDTEL-----------------PRSM 394
            :|.|..:|..||||..|:.|.::.|..|         .:|.|.|                 |.::
plant   288 NNFIGRVPSSLSKLVNLELLDLSHNNFRGLSPRSISKLVNLTSLDISYNKLEGQVPYFIWKPSNL 352

  Fly   395 QMLDMRANPLSTISP-----------GAFRGMSKLRK--------------LILSDVRTLRSFPE 434
            |.:|:..|....:..           |...|.:.|:.              |.|||.|...|.|:
plant   353 QSVDLSHNSFFDLGKSVEVVNGAKLVGLNLGSNSLQGPIPQWICNFRFVFFLDLSDNRFTGSIPQ 417

  Fly   435 -LEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNS-LKRIP-NLSSCRDLRLLDLSSNQ 496
             |:.......|.|....:......||..:..|:||::..|: :.::| :|.:|:|:..|::..|:
plant   418 CLKNSTDFNTLNLRNNSLSGFLPELCMDSTMLRSLDVSYNNFVGKLPKSLMNCQDMEFLNVRGNK 482

  Fly   497 IEKIQGKPF--NGLKQLNDLLLSYNRI--KALPQDAFQGIPKLQLLDLEGNE-ISYIHKEAFSGF 556
            |:  ...||  ...|.|..|:|..|..  .......:.|.|:|.::|:..|: :..:.::.|:.:
plant   483 IK--DTFPFWLGSRKSLMVLVLRSNAFYGPVYNSTTYLGFPRLSIIDISNNDFVGSLPQDYFANW 545

  Fly   557 TALE---DLN------------------------------------------------------- 563
            |.:.   |:|                                                       
plant   546 TEMATVWDINRLNYARNTSSRTIQYGGLQTIQRSNYVGDNFNMHADSMDLAYKGVDTDFNRIFRG 610

  Fly   564 ------LGNNIFPELPES-GLRA-LLHLKTFNNPKLREFPPP-DTFPRIQTLILSYAYHCCAFLP 619
                  .||.....:|.| ||.: ||||....|......||. .....::||.||          
plant   611 FKVIDFSGNRFSGHIPRSIGLLSELLHLNLSGNAFTGNIPPSLANITNLETLDLS---------- 665

  Fly   620 LVAMSSQKKTSQVQEAVLFPSDAEFDMTLWNNSMMNIWPQMHNLSKQLGASMHD-PWETAINFNE 683
                                                    .:|||.::..|:.: .:.:.|||:.
plant   666 ----------------------------------------RNNLSGEIPRSLGNLSFLSNINFSH 690

  Fly   684 EQLQ------TQTGGQIATSYM---------EEYFEEHDVSGP--------------------AT 713
            ..||      ||.|.|..:|::         |...|.|.|..|                    |.
plant   691 NHLQGFVPRSTQFGTQNCSSFVGNPGLYGLDEICRESHHVPVPTSQQHDGSSSELEEPVLNWIAA 755

  Fly   714 GYGFGTGLFSG 724
            ...||.|:|.|
plant   756 AIAFGPGVFCG 766

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 61/222 (27%)
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566 19/53 (36%)
leucine-rich repeat 205..228 CDD:275380 5/18 (28%)
leucine-rich repeat 229..252 CDD:275380 9/23 (39%)
LRR_8 252..311 CDD:290566 25/97 (26%)
leucine-rich repeat 253..276 CDD:275380 9/23 (39%)
leucine-rich repeat 277..300 CDD:275380 10/46 (22%)
LRR_8 299..359 CDD:290566 19/86 (22%)
leucine-rich repeat 301..324 CDD:275380 10/47 (21%)
leucine-rich repeat 325..348 CDD:275380 6/24 (25%)
LRR_RI 327..567 CDD:238064 69/365 (19%)
leucine-rich repeat 349..371 CDD:275380 9/23 (39%)
LRR_8 370..425 CDD:290566 17/106 (16%)
leucine-rich repeat 372..393 CDD:275380 8/47 (17%)
leucine-rich repeat 394..415 CDD:275380 5/32 (16%)
leucine-rich repeat 418..486 CDD:275380 20/85 (24%)
leucine-rich repeat 441..464 CDD:275378 4/23 (17%)
LRR_8 487..545 CDD:290566 15/63 (24%)
leucine-rich repeat 487..510 CDD:275380 6/25 (24%)
leucine-rich repeat 511..534 CDD:275380 6/25 (24%)
LRR_8 533..589 CDD:290566 19/123 (15%)
leucine-rich repeat 535..558 CDD:275380 5/24 (21%)
leucine-rich repeat 559..580 CDD:275380 8/87 (9%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
RLP38NP_188953.1 PLN00113 11..>721 CDD:331614 142/680 (21%)
leucine-rich repeat 112..135 CDD:275380 9/23 (39%)
leucine-rich repeat 136..159 CDD:275380 9/23 (39%)
leucine-rich repeat 160..183 CDD:275380 8/23 (35%)
leucine-rich repeat 184..206 CDD:275380 2/22 (9%)
leucine-rich repeat 207..254 CDD:275380 10/47 (21%)
leucine-rich repeat 255..276 CDD:275380 6/21 (29%)
leucine-rich repeat 280..303 CDD:275380 9/23 (39%)
leucine-rich repeat 304..327 CDD:275380 4/23 (17%)
leucine-rich repeat 352..376 CDD:275380 3/24 (13%)
leucine-rich repeat 377..397 CDD:275380 3/20 (15%)
leucine-rich repeat 401..424 CDD:275380 8/23 (35%)
leucine-rich repeat 425..448 CDD:275380 4/23 (17%)
leucine-rich repeat 449..472 CDD:275380 7/23 (30%)
leucine-rich repeat 473..496 CDD:275380 6/25 (24%)
leucine-rich repeat 523..545 CDD:275380 4/22 (18%)
leucine-rich repeat 659..682 CDD:275380 8/73 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.