DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rk and drc3

Sequence 1:NP_476702.1 Gene:rk FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_021327254.1 Gene:drc3 ZFINID:ZDB-GENE-061103-349 Length:514 Species:Danio rerio

Alignment Length:442 Identity:95/443 (21%)
Similarity:165/443 (37%) Gaps:123/443 (28%)


  Fly   292 TNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDD 356
            |....|::..|.|.|..:...|:.........:|..|.|..|.|.:|.  .|:|||.|..|:|..
Zfish    26 TRYTEGIQLEEVLELRLDYRNILKIYHLWSFSSLTKLQLDNNAIERIE--GLENLTNLTWLDLSF 88

  Fly   357 NLISSLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLSTISPGAFRGMSKLRKL 421
            |.|..: |||..|.:||:||:.:||:..|.:.:..:.:|:|.:..|.::.               
Zfish    89 NKIEVI-EGLQTLVKLQDLSLFNNRISVIENLDTLQRLQVLSLGNNSIAQ--------------- 137

  Fly   422 ILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPNLSSCRD 486
             |.:|..||.|..|..        |:.||           .|..:....||.....:|.|... |
Zfish   138 -LENVIYLRRFQSLRT--------LNLAG-----------NPICEEDRYKTFVSAYLPELVYL-D 181

  Fly   487 LRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYIHKE 551
            .||||..:.:....:              ..| .|:.:.|:..|....::...:...|:. :||:
Zfish   182 YRLLDEQTRETANAK--------------YQY-AIEEMRQNEMQEQQAMEAQKISNEELQ-LHKD 230

  Fly   552 AFSGFTALEDLN---LGNNIFPELPESGLRALLH-----LKTFNNPKLREFPPPDTFPRIQTLIL 608
            ||     :|:||   |.:::|.:.|::...|||.     |:.|.:             |::.:.:
Zfish   231 AF-----VENLNGAQLFHSMFADDPDAEKLALLPGVDALLEEFRS-------------RMEAVCM 277

  Fly   609 SY----------------AYHCCAFLPLVAMSSQK--------------KTS---QVQEAVLFPS 640
            ..                ::..|: ...||.:.||              ||:   |:|:||    
Zfish   278 QMFEAGLSQYSRRSAEVESFFSCS-REAVAENKQKAAQIAADFESFRRLKTAEMHQIQDAV---- 337

  Fly   641 DAEFDMTLWNNSMMNIWPQMHNLSKQLGASMHDPWETAINFNEEQLQTQTGG 692
            ..|..:::....:.:...|:.:|..||...:.|.::..    |..:....||
Zfish   338 QLETHLSVCRQQLTHTSEQLMSLELQLVDQLEDVYKEF----ERNISEMLGG 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 31/91 (34%)
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_8 252..311 CDD:290566 5/19 (26%)
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380 2/8 (25%)
LRR_8 299..359 CDD:290566 18/60 (30%)
leucine-rich repeat 301..324 CDD:275380 4/23 (17%)
leucine-rich repeat 325..348 CDD:275380 10/23 (43%)
LRR_RI 327..567 CDD:238064 60/243 (25%)
leucine-rich repeat 349..371 CDD:275380 9/22 (41%)
LRR_8 370..425 CDD:290566 11/55 (20%)
leucine-rich repeat 372..393 CDD:275380 7/21 (33%)
leucine-rich repeat 394..415 CDD:275380 3/21 (14%)
leucine-rich repeat 418..486 CDD:275380 14/68 (21%)
leucine-rich repeat 441..464 CDD:275378 4/23 (17%)
LRR_8 487..545 CDD:290566 9/58 (16%)
leucine-rich repeat 487..510 CDD:275380 4/23 (17%)
leucine-rich repeat 511..534 CDD:275380 4/23 (17%)
LRR_8 533..589 CDD:290566 16/64 (25%)
leucine-rich repeat 535..558 CDD:275380 5/23 (22%)
leucine-rich repeat 559..580 CDD:275380 7/24 (29%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
drc3XP_021327254.1 leucine-rich repeat 39..58 CDD:275380 2/19 (11%)
leucine-rich repeat 59..80 CDD:275378 10/23 (43%)
LRR_9 61..198 CDD:317038 47/190 (25%)
leucine-rich repeat 81..102 CDD:275378 9/22 (41%)
leucine-rich repeat 103..124 CDD:275378 7/21 (33%)
leucine-rich repeat 125..149 CDD:275378 8/40 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.