DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rk and Lgr6

Sequence 1:NP_476702.1 Gene:rk FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_001062538.1 Gene:Lgr6 RGDID:1560339 Length:965 Species:Rattus norvegicus

Alignment Length:973 Identity:297/974 (30%)
Similarity:441/974 (45%) Gaps:170/974 (17%)


  Fly   152 CHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSII 216
            |||.....:|...|..:|:..||.:|......|||..||||:|:...|.....||||.||.|.:.
  Rat    39 CHCQEDGIMLSADCSELGLSEVPADLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLS 103

  Fly   217 NMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSL------DGDCLGHLQ 275
            ::...||.||..||.|.||:..|:.:|.::...|..|.||:|:.| |:||      :|     |.
  Rat   104 HIPRQAFSGLHSLKILMLQSNQLRGIPAEALWELPSLQSLRLDAN-LISLVPERSFEG-----LS 162

  Fly   276 KLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISA 340
            .||.|.|:.|....||..||..|..|:|:.|..|.:..|.|..|..:.:|:||.|..|:|..:..
  Rat   163 SLRHLWLDDNALTEIPVRALNNLPALQAMTLALNRIRHIPDYAFQNLTSLVVLHLHNNRIQHVGT 227

  Fly   341 GALKNLTALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELPRS--MQMLDMRANP 403
            .:.:.|..|:.|:|:.|.:...|..:..|.:||||...:|.::.|.:.....:  :|.:....||
  Rat   228 HSFEGLHNLETLDLNYNELQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNP 292

  Fly   404 LSTISPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSL 468
            :..:...||:.:|||..|.|:....::.||:|:...:||||.|.||||:.:||.:|:|.|||:.|
  Rat   293 IQFVGRSAFQYLSKLHTLSLNGATDIQEFPDLKGTTSLEILTLTRAGIRLLPAGMCQQLPRLRIL 357

  Fly   469 ELKTNSLKRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIP 533
            ||..|.::.:|:|..|                        ::|.::.|.:|||..:..|.|..:.
  Rat   358 ELSHNQIEELPSLHRC------------------------QKLEEIGLQHNRIWEIGADTFSQLS 398

  Fly   534 KLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNNPKLREFPPPD 598
            .||.|||..|.|..||.||||...:|..|:|.:|....||.:||..|:|||...|..|.:....|
  Rat   399 SLQALDLSWNAIRAIHPEAFSTLRSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKD 463

  Fly   599 TFPRIQTLILSYAYHCCAFLPLVAMSSQKKTSQVQEAVLFPSDAEFDMTLWNNSMMNIWPQMHNL 663
            :||:::.|.:.|||.|||:                                              
  Rat   464 SFPKLRILEVPYAYQCCAY---------------------------------------------- 482

  Fly   664 SKQLGASMHDPWETAINFNEEQLQTQTGGQIATSYMEEYFEEHDVSGPATGYGFGTGLFSG---- 724
                        ....||      .:|.||    :..|.|...:...|....|...|....    
  Rat   483 ------------GLCANF------FKTSGQ----WQAEDFHAEEEEAPKRPLGLLAGQAENHYDL 525

  Fly   725 ------MSTEDFQP-GSVQCLPMPGPFLPCADLFDWWTLRCGVWVVFLLSLLGNGTVVFVLLC-S 781
                  |.|||.:| .||||.|:||||.||..||:.|.:|..||.:.|||:|.||.|:..:.. .
  Rat   526 DLDELQMETEDSKPHPSVQCSPVPGPFKPCEHLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGG 590

  Fly   782 RSKMDVPRFLVCNLAAADFFMGIYLGILAIVDAATLGEFRMFAIPWQMSVLCQLSGFLAVLSSEL 846
            .|.:...:.:|..:|.|:...||..|:||.|||.|.|:|..:...|:..:.||.:||||||.||.
  Rat   591 PSPLSPVKLVVGAIAGANALTGISCGLLASVDALTFGQFAEYGARWETGLGCQATGFLAVLGSEA 655

  Fly   847 SVYTLAVITLERNYAITHAIHLNKRLSLKQAGYIMSVGWV---------FALIMALMPLVGVSDY 902
            ||..|.:..::.:.::|         .::..|...|.|.|         .|.:.|.:||..|.:|
  Rat   656 SVLLLTLAAVQCSVSVT---------CVRAYGKAPSPGSVRAGALGCLALAGLAAALPLASVGEY 711

  Fly   903 RKFAVCLPFETTTG-PASLTYVISLMFINGCAFLTLMGCYLKMYWAI-RG--SQAWNTNDSRIAK 963
            ....:|||:....| ||:|.:.::|:.:|...||.:.|.|:|:|..: ||  ...|   |..:.:
  Rat   712 GASPLCLPYAPPEGRPAALGFAVALVMMNSLCFLVVAGAYIKLYCDLPRGDFEAVW---DCAMVR 773

  Fly   964 RMALLVFTDFLCWSPIAFFSITAIFGLQLISLEQAKIFTVFVLPLNSCCNPFLYAIMTKQFKKDC 1028
            .:|.|:|.|.|.:.|:||.|..::.||..::.|..|...:.||||.:|.||.||.:....|::|.
  Rat   774 HVAWLIFADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFREDL 838

  Fly  1029 VTLCKHFEESRVVGGGGPGGRGAVARTKRGDLPPP----------------LLPAAAVAHPPG 1075
            ..|..           .|...|.:|.|..|:|...                :|.|:....|||
  Rat   839 RRLWP-----------SPRSPGPLAYTAAGELEKSSCDSTQALVAFSDVDLILEASEAGQPPG 890

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 6/21 (29%)
LRR_RI 180..>383 CDD:238064 73/209 (35%)
leucine-rich repeat 183..204 CDD:275380 9/21 (43%)
LRR_8 203..263 CDD:290566 24/60 (40%)
leucine-rich repeat 205..228 CDD:275380 11/23 (48%)
leucine-rich repeat 229..252 CDD:275380 8/23 (35%)
LRR_8 252..311 CDD:290566 24/65 (37%)
leucine-rich repeat 253..276 CDD:275380 10/29 (34%)
leucine-rich repeat 277..300 CDD:275380 10/23 (43%)
LRR_8 299..359 CDD:290566 18/60 (30%)
leucine-rich repeat 301..324 CDD:275380 7/23 (30%)
leucine-rich repeat 325..348 CDD:275380 7/23 (30%)
LRR_RI 327..567 CDD:238064 77/242 (32%)
leucine-rich repeat 349..371 CDD:275380 6/22 (27%)
LRR_8 370..425 CDD:290566 16/57 (28%)
leucine-rich repeat 372..393 CDD:275380 6/21 (29%)
leucine-rich repeat 394..415 CDD:275380 5/21 (24%)
leucine-rich repeat 418..486 CDD:275380 29/68 (43%)
leucine-rich repeat 441..464 CDD:275378 14/23 (61%)
LRR_8 487..545 CDD:290566 13/58 (22%)
leucine-rich repeat 487..510 CDD:275380 0/23 (0%)
leucine-rich repeat 511..534 CDD:275380 7/23 (30%)
LRR_8 533..589 CDD:290566 26/56 (46%)
leucine-rich repeat 535..558 CDD:275380 13/23 (57%)
leucine-rich repeat 559..580 CDD:275380 8/21 (38%)
7tm_4 764..>892 CDD:304433 42/138 (30%)
7tm_1 770..1017 CDD:278431 83/261 (32%)
Lgr6XP_001062538.1 LRRNT 34..68 CDD:214470 9/29 (31%)
LRR_RI <70..248 CDD:238064 66/184 (36%)
leucine-rich repeat 70..91 CDD:275380 9/21 (43%)
LRR_8 92..150 CDD:290566 25/59 (42%)
leucine-rich repeat 92..115 CDD:275380 11/23 (48%)
leucine-rich repeat 116..139 CDD:275380 8/23 (35%)
LRR_8 138..198 CDD:290566 24/66 (36%)
leucine-rich repeat 140..163 CDD:275380 10/29 (34%)
leucine-rich repeat 164..187 CDD:275380 10/23 (43%)
LRR_8 186..246 CDD:290566 18/60 (30%)
leucine-rich repeat 188..211 CDD:275380 7/23 (30%)
leucine-rich repeat 212..235 CDD:275380 7/23 (30%)
leucine-rich repeat 236..258 CDD:275380 6/22 (27%)
LRR_RI 253..>442 CDD:238064 70/213 (33%)
LRR_8 258..314 CDD:290566 16/56 (29%)
leucine-rich repeat 259..282 CDD:275380 6/23 (26%)
leucine-rich repeat 283..304 CDD:275380 5/21 (24%)
LRR_8 305..364 CDD:290566 28/59 (47%)
leucine-rich repeat 330..344 CDD:275378 9/14 (64%)
leucine-rich repeat 354..375 CDD:275380 8/45 (18%)
LRR_8 375..434 CDD:290566 24/59 (41%)
leucine-rich repeat 376..399 CDD:275380 7/23 (30%)
leucine-rich repeat 400..421 CDD:275380 13/21 (62%)
leucine-rich repeat 424..444 CDD:275380 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2087
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 380 1.000 Inparanoid score I1966
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D171884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T618184
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.920

Return to query results.
Submit another query.