DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rk and Lgr3

Sequence 1:NP_476702.1 Gene:rk FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_733115.1 Gene:Lgr3 FlyBaseID:FBgn0039354 Length:765 Species:Drosophila melanogaster

Alignment Length:805 Identity:189/806 (23%)
Similarity:274/806 (34%) Gaps:227/806 (28%)


  Fly   283 EGNLFYRIPTNALAGLRTLEALNLG-SNLLTIIN-----DEDFPRMPNLIVLLLKRNQIMKISAG 341
            :|.:.|   ....|.||....|:.. :||:.|.|     |..|.....|..|.||.|.|.::..|
  Fly   136 QGTILY---CGRYAKLRRFPRLSSEVTNLIIIRNNLTLRDNIFANFTRLQKLTLKYNNISRVPLG 197

  Fly   342 ALKNLTALKVLELDDNLISSLPEGL-SKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLS 405
            :...|..|:.|||..|.:|.||.|: ..|..||.|.:.:|.|.     .||              
  Fly   198 SFSGLFHLERLELSHNNVSHLPHGVFLGLHSLQWLFLVNNHLH-----HLP-------------- 243

  Fly   406 TISPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLEL 470
                                |..||.|      ..||.|.|.|                 ..|.|
  Fly   244 --------------------VEQLRFF------RRLEWLVLSR-----------------NRLTL 265

  Fly   471 KTNSLKRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKL 535
            :...|.:||.                              |.::.|.:|||:.:.::.|..:..|
  Fly   266 RNVQLPKIPT------------------------------LYEVYLDFNRIEYIGEETFSQLDNL 300

  Fly   536 QLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNNPKLREFPPPDTF 600
            .||||:.|.|::||..||:..|.:.|:.|..|...||  ||                     :||
  Fly   301 HLLDLQHNLITHIHGRAFANLTNMRDIRLVGNPIKEL--SG---------------------ETF 342

  Fly   601 ---PRIQTLILSYAYHCCAFLPLVAMSSQKKTSQVQEAVLFPSDAEFDMTLWNNSMMNIWPQMHN 662
               .|::.|.|       |.:|:...||.                   |...|.|.:|:      
  Fly   343 LHNTRLEALSL-------ALMPIHISSSL-------------------MEPLNISFLNL------ 375

  Fly   663 LSKQLGASMHDPWETAINFNEEQLQTQTGGQIATSYMEEYFEEHDVSGPATGYGFGTGLFSGMST 727
                          |.|.::....:.....:..|..:.:.|                 .:..|: 
  Fly   376 --------------TGIRYDHIDFEAINSMRNLTYIIYDRF-----------------FYCSMT- 408

  Fly   728 EDFQPGSVQCLPMPGPFLPCADLFDWWTLRCGVWVVFLLSLLGNGTVVFVLLCSRSKMDVPRFLV 792
                |....|.|.........||.....||...||:..|::.||..|::.....|.:......::
  Fly   409 ----PRVRMCKPSTDGVSSFQDLLSKPVLRYSAWVMATLTIAGNVLVLWGRFIYRDENVAVTMVI 469

  Fly   793 CNLAAADFFMGIYLGILAIVDAATLGEFRMFAIPWQMSVLCQLSGFLAVLSSELSVYTLAVITLE 857
            .|||.||..||.||..:.:.|.....|:....:.|..|..|.|.|.|||.|||:|:..||.::||
  Fly   470 RNLALADMLMGFYLVTIGVQDYRYRNEYYKVVLDWITSWQCTLIGTLAVSSSEVSMLILAFMSLE 534

  Fly   858 RNYAITHAIHLNKRLSLKQAGYIMSVGWVFALIMALMPLV-----GVSDYRKFA-VCLPFETTTG 916
            |...|......::.:..:.....:...|:..:.:|:.|::     .:..|..:: .|.|......
  Fly   535 RFLLIADPFRGHRSIGNRVMWLALICIWITGVGLAVAPVLLWRTSTLPYYGSYSGTCFPLHIHEA 599

  Fly   917 -PASLTYVISLMFINGCAFLTLM-----GCYLKMYWAIRGSQAWNTNDSRIAKRMALLVFTDFLC 975
             |....| .:.:|:.....|.:|     ...|...|..|.:......|...|.|...:|.|||||
  Fly   600 FPMGWLY-SAFVFLGVNLLLLVMIAMLYTALLISIWRTRSATPLTLLDCEFAVRFFFIVLTDFLC 663

  Fly   976 WSPIAFFSITAIFGLQLISLEQAKIFTVFVLPLNSCCNPFLYAIMTKQFKKDC-------VTLCK 1033
            |.||....|...|... ||.:......||||||||..||.||...|.:::...       :|..|
  Fly   664 WVPIIVMKIWVFFNYN-ISDDIYAWLVVFVLPLNSAVNPLLYTFTTPKYRNQIFLRGWKKITSRK 727

  Fly  1034 HFEESRVVGGGGPGGRGAVARTKRG 1058
            ..|          .|.|.||.|..|
  Fly   728 RAE----------AGNGNVATTTTG 742

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 35/107 (33%)
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_8 252..311 CDD:290566 8/29 (28%)
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380 5/17 (29%)
LRR_8 299..359 CDD:290566 21/66 (32%)
leucine-rich repeat 301..324 CDD:275380 7/29 (24%)
leucine-rich repeat 325..348 CDD:275380 8/23 (35%)
LRR_RI 327..567 CDD:238064 58/241 (24%)
leucine-rich repeat 349..371 CDD:275380 10/23 (43%)
LRR_8 370..425 CDD:290566 7/55 (13%)
leucine-rich repeat 372..393 CDD:275380 7/21 (33%)
leucine-rich repeat 394..415 CDD:275380 0/21 (0%)
leucine-rich repeat 418..486 CDD:275380 14/68 (21%)
leucine-rich repeat 441..464 CDD:275378 5/23 (22%)
LRR_8 487..545 CDD:290566 12/58 (21%)
leucine-rich repeat 487..510 CDD:275380 0/23 (0%)
leucine-rich repeat 511..534 CDD:275380 6/23 (26%)
LRR_8 533..589 CDD:290566 19/56 (34%)
leucine-rich repeat 535..558 CDD:275380 12/23 (52%)
leucine-rich repeat 559..580 CDD:275380 7/21 (33%)
7tm_4 764..>892 CDD:304433 35/128 (27%)
7tm_1 770..1017 CDD:278431 74/259 (29%)
Lgr3NP_733115.1 LDLa 32..65 CDD:238060
LRR_8 179..239 CDD:290566 22/60 (37%)
leucine-rich repeat 181..204 CDD:275380 8/23 (35%)
LRR_RI <196..354 CDD:238064 63/280 (23%)
leucine-rich repeat 205..228 CDD:275380 10/23 (43%)
leucine-rich repeat 229..252 CDD:275380 11/68 (16%)
leucine-rich repeat 253..275 CDD:275380 10/39 (26%)
LRR_8 274..334 CDD:290566 22/90 (24%)
leucine-rich repeat 276..299 CDD:275380 6/23 (26%)
leucine-rich repeat 300..323 CDD:275380 12/23 (52%)
leucine-rich repeat 324..347 CDD:275380 9/46 (20%)
7tm_1 447..704 CDD:278431 74/259 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2087
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24372
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.