DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rk and Lgr1

Sequence 1:NP_476702.1 Gene:rk FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_524393.2 Gene:Lgr1 FlyBaseID:FBgn0016650 Length:831 Species:Drosophila melanogaster

Alignment Length:828 Identity:243/829 (29%)
Similarity:385/829 (46%) Gaps:170/829 (21%)


  Fly   297 GLRTLE-----ALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAG--ALKNLTALKVLEL 354
            ||:.|.     .|.|...|||.::...|....:.:...|..|....|..|  ...||||:.:.:.
  Fly    20 GLKCLSFEFQCRLLLHHLLLTSLSGRHFVYATSAVGGALSANNCHDIHHGFDVYPNLTAVSLAQS 84

  Fly   355 DDN-LISSLP------------------------EGLSKLSQ-----LQELSITSNRLRWINDTE 389
            .|. |.:::|                        :||:::.|     :|.|:|.|..|..:..|.
  Fly    85 TDTPLTATMPRSAWKCCCWNASNQAEEVECRCEGDGLNRVPQTLTLPIQRLTIASAGLPRLRHTG 149

  Fly   390 LP-RSMQMLDMRAN---PLSTISPGAFRGMSKLRKLILSDVRTLRSFPE---LEACHALEILKLD 447
            |. ....:||:...   .|..|..|||..::.||.:.:::...|....:   |.....::|:::.
  Fly   150 LKVYGSTLLDVAFTDCLQLELIQDGAFANLTLLRTIYITNAPKLTFLSKDVFLGISDTVDIIRII 214

  Fly   448 RAGIQEVPANLCRQTPRLKSLELKTNSLKRIP--NLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQ 510
            .:|:..||                  .|..:|  |:     |:::||.:|||.:|..|...  .:
  Fly   215 NSGLTRVP------------------DLGHLPPHNI-----LQMIDLDNNQITRIDSKSIK--VK 254

  Fly   511 LNDLLLSYNRIKALPQDAFQG--IPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPELP 573
            ...|:|:.|.|..:...||.|  |.||.|  .|..::..:|..||.|...:.:|:|.:.....||
  Fly   255 TAQLILTNNEISYVDDSAFFGSKIAKLSL--KENKKLQMMHPNAFDGIIDITELDLSSTSLVGLP 317

  Fly   574 ESGLRALLHLKTFNNPKLREFPPPDTFPRIQTLILSYAYHCCAFLPLVAMSSQKKTSQVQEAVLF 638
            .:||:.:..|...|...|:..|....|..:|...|::::|||||                   .|
  Fly   318 SAGLQNIEALYIQNTHTLKTIPSIYNFRNLQRAYLTHSFHCCAF-------------------QF 363

  Fly   639 PSDAEFDMTLWNNSMMNIWPQMHNLSKQLGASMHDPWETAINFNE-----EQLQTQTGGQIATSY 698
            |                              |.|||...|....|     :|.::.:|.:...|.
  Fly   364 P------------------------------SRHDPQRHAQRMLEIEKWRKQCKSDSGTRKERST 398

  Fly   699 MEEYFEEHDVSG-------------PATGYGF--------GTGLF---------SGMSTE----- 728
            ::..|...:..|             |.|...|        ..|.|         ...|.|     
  Fly   399 LDNPFNMPEDFGSFGGTDDSATDITPITFASFDYMADDTMNKGTFHEKIILNPGDDSSAELCGNF 463

  Fly   729 DFQPGSVQCLPMPGPFLPCADLFDWWTLRCGVWVVFLLSLLGNGTVVFVLLCSR-SKMDVPRFLV 792
            .|:..:::|.|||....||.|:..:..||..||:|..|:::||..|:.|:|..| ....|||||:
  Fly   464 TFRKPNIECYPMPNDLNPCEDVMGYQWLRISVWIVVALAVVGNVAVLTVILSIRPESTPVPRFLM 528

  Fly   793 CNLAAADFFMGIYLGILAIVDAATLGEFRMFAIPWQMSVLCQLSGFLAVLSSELSVYTLAVITLE 857
            |:||.||..:|:||.::|.:||.::||:..||..||..:.|:::|||.|.:|.|||:||.|||:|
  Fly   529 CHLAFADLCLGLYLLLVACIDAHSMGEYFNFAYDWQYGLGCKVAGFLTVFASHLSVFTLTVITIE 593

  Fly   858 RNYAITHAIHLNKRLSLKQAGYIMSVGWVFALIMALMPLVGVSDYRKFAVCLPFETTTGPASLTY 922
            |..|||.|::||.|:.|:.|..||..||:::::|:.:||.|:|:|...::|||.|......:: |
  Fly   594 RWLAITQAMYLNHRIKLRPAALIMLGGWIYSMLMSSLPLFGISNYSSTSICLPMENRDVYDTI-Y 657

  Fly   923 VISLMFINGCAFLTLMGCYLKMYWAI----RGSQAWNTNDSRIAKRMALLVFTDFLCWSPIAFFS 983
            :|:::..||.||..:..||.::|.::    |.:...:..:..:||:|||||||:|.||||||||.
  Fly   658 LIAILGSNGVAFSIIAVCYAQIYLSLGRETRQAHQNSPGELSVAKKMALLVFTNFACWSPIAFFG 722

  Fly   984 ITAIFGLQLISLEQAKIFTVFVLPLNSCCNPFLYAIMTKQFKKDCVTL 1031
            :||:.|..||::.::||..||..|||||.:|:||||:|.|:::|..||
  Fly   723 LTALAGYPLINVTKSKILLVFFYPLNSCADPYLYAILTSQYRQDLFTL 770

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 28/123 (23%)
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_8 252..311 CDD:290566 6/19 (32%)
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380 2/3 (67%)
LRR_8 299..359 CDD:290566 17/68 (25%)
leucine-rich repeat 301..324 CDD:275380 7/28 (25%)
leucine-rich repeat 325..348 CDD:275380 7/25 (28%)
LRR_RI 327..567 CDD:238064 65/283 (23%)
leucine-rich repeat 349..371 CDD:275380 5/47 (11%)
LRR_8 370..425 CDD:290566 17/64 (27%)
leucine-rich repeat 372..393 CDD:275380 7/22 (32%)
leucine-rich repeat 394..415 CDD:275380 7/24 (29%)
leucine-rich repeat 418..486 CDD:275380 11/73 (15%)
leucine-rich repeat 441..464 CDD:275378 4/23 (17%)
LRR_8 487..545 CDD:290566 20/60 (33%)
leucine-rich repeat 487..510 CDD:275380 8/23 (35%)
leucine-rich repeat 511..534 CDD:275380 8/25 (32%)
LRR_8 533..589 CDD:290566 16/56 (29%)
leucine-rich repeat 535..558 CDD:275380 7/23 (30%)
leucine-rich repeat 559..580 CDD:275380 6/21 (29%)
7tm_4 764..>892 CDD:304433 59/129 (46%)
7tm_1 770..1017 CDD:278431 111/252 (44%)
Lgr1NP_524393.2 leucine-rich repeat 324..346 CDD:275380 5/22 (23%)
7tm_1 505..756 CDD:278431 111/252 (44%)
leucine-rich repeat 182..207 CDD:275380 4/25 (16%)
leucine-rich repeat 208..231 CDD:275380 6/41 (15%)
leucine-rich repeat 233..256 CDD:275380 8/25 (32%)
leucine-rich repeat 257..277 CDD:275380 7/20 (35%)
LRR_8 258..313 CDD:290566 18/57 (32%)
leucine-rich repeat 278..302 CDD:275380 9/26 (35%)
leucine-rich repeat 303..323 CDD:275380 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2087
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001020
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24372
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.