DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rk and Rxfp1

Sequence 1:NP_476702.1 Gene:rk FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_006232570.1 Gene:Rxfp1 RGDID:1302973 Length:763 Species:Rattus norvegicus

Alignment Length:911 Identity:205/912 (22%)
Similarity:335/912 (37%) Gaps:275/912 (30%)


  Fly   163 LSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSIINMDPNAFYGLA 227
            |.|.|:.      :..|:....:.|:||...|:.:.:|  .|..:|| |.|||            
  Rat    51 LHCNGVD------DCGNQADEDNC
GDNNGWSLQLDKYF--ANYYKLT-STNSI------------ 94

  Fly   228 KLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLRLEGNLFYRIPT 292
               ......|.:.|:|........:|...:.|..|:.|:..:       :..:.|:.|....:|.
  Rat    95 ---EAETSECLVGSVPMHCLCRDLELDCDEANLRAVPSVSSN-------VTVMSLQWNFIRTLPP 149

  Fly   293 NALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDN 357
            |:                        |....:|..|.|:.|:|..:|..|.:.|.:|..|.|..|
  Rat   150 NS------------------------FRMYHDLQKLCLQNNKIRSVSVSAFRGLHSLTKLYLSHN 190

  Fly   358 LISSLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLSTISPGAFRGMSKLRKLI 422
            .|:.|..|:     .::|    :||.|            |.:..|.||.|||..|.|::.|..|:
  Rat   191 RITFLKPGV-----FEDL----HRLEW------------LIIEDNHLSRISPLTFYGLNSLILLV 234

  Fly   423 LSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPNLS--SCR 485
            |.: ..|...|:                     ..||:..|||..|:.:.|.:..:.||:  ||.
  Rat   235 LMN-NALTRLPD---------------------KPLCQHMPRLHWLDFEGNRIHNLRNLTFISCN 277

  Fly   486 DLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYIHK 550
            :|.:|.:..|:|..:....|..|::|::|.|..|:|:.||.:.|:.:.:|..|::..|.|..|..
  Rat   278 NLTVLVMRKNKINHLNEHAFTHLQKLDELDLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEV 342

  Fly   551 EAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNNPKLREFPPPDTFPRIQTLILSYAY--- 612
            ..|.....|:.|..|..|                  :|.:.|.|.|        .:.||:.|   
  Rat   343 NQFDYLAKLKSLLEGIEI------------------SNIQQRMFRP--------LINLSHIYFKK 381

  Fly   613 -HCCAFLPLVAMSSQKKTSQVQEAVLFPSDAEFDMTLWNNSMMNIWPQMHNLSKQLGASMHDPWE 676
             ..|.:.|.| .|.:..|..:                  :|:.|                     
  Rat   382 FQYCGYAPHV-RSCKPNTDGI------------------SSLEN--------------------- 406

  Fly   677 TAINFNEEQLQTQTGGQIATSYMEEYFEEHDVSGPATGYGFGTGLFSGMSTEDFQPGSVQCLPMP 741
                             :..|.::..|                                      
  Rat   407 -----------------LLASIIQRVF-------------------------------------- 416

  Fly   742 GPFLPCADLFDWWTLRCGVWVVFLLSLLGNGTVVFVLLCSRSKMDVPRFLVCNLAAADFFMGIYL 806
                              ||||..::..||..|:.:....||:..:....:.:|..||..||:||
  Rat   417 ------------------VWVVSAITCFGNIFVICMRPYIRSENKLHAMSIMSLCCADCLMGVYL 463

  Fly   807 GILAIVDAATLGEFRMFAIPWQMSVLCQLSGFLAVLSSELSVYTLAVITLERNYAITHAIHLNKR 871
            .::...|....||:|..|.||..||.||..|.|||||:|:||..|..:|||:...|.:.....:.
  Rat   464 FVIGAFDLKFRGEYRKHAQPWMESVHCQFMGSLAVLSTEVSVLLLTFLTLEKYICIVYPFRCLRP 528

  Fly   872 LSLKQAGYIMSVGWVFALIMALMPLVGVSDYRKF----AVCLPFET----TTGPASLTYVISLMF 928
            ...:....::.: |:...|:|..||.....::.:    .||.|..:    :|| |.:..|:..:.
  Rat   529 RKCRTVAVLIFI-WITGFIVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTG-AQIYSVVIFLG 591

  Fly   929 INGCAFLTLMGCYLKMYWAIRGSQAWNTNDSR-------IAKRMALLVFTDFLCWSPIAFFSITA 986
            ||..||:.::..|..|::::..|....|...:       :|||...:||||.|||.|        
  Rat   592 INLVAFIIIVFSYGSMFYSVHQSTITATEIQKQVKKEMILAKRFFFIVFTDALCWIP-------- 648

  Fly   987 IFGLQLISLEQAKI-------FTVFVLPLNSCCNPFLYAIMTKQFKKDCVTLCKHFEESRVVGGG 1044
            ||.|:.:||.:.:|       ..:|:||:||..||.:|.:.|:.||:....|..::.:.|.|...
  Rat   649 IFILKFLSLIRVEIPDTITSWVVIFILPINSALNPIIYTLTTRPFKEMIHQLWYNYRQRRSVDRK 713

  Fly  1045 G 1045
            |
  Rat   714 G 714

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 3/16 (19%)
LRR_RI 180..>383 CDD:238064 42/203 (21%)
leucine-rich repeat 183..204 CDD:275380 5/21 (24%)
LRR_8 203..263 CDD:290566 13/60 (22%)
leucine-rich repeat 205..228 CDD:275380 6/23 (26%)
leucine-rich repeat 229..252 CDD:275380 3/23 (13%)
LRR_8 252..311 CDD:290566 8/59 (14%)
leucine-rich repeat 253..276 CDD:275380 4/23 (17%)
leucine-rich repeat 277..300 CDD:275380 4/23 (17%)
LRR_8 299..359 CDD:290566 13/60 (22%)
leucine-rich repeat 301..324 CDD:275380 1/23 (4%)
leucine-rich repeat 325..348 CDD:275380 8/23 (35%)
LRR_RI 327..567 CDD:238064 66/242 (27%)
leucine-rich repeat 349..371 CDD:275380 7/22 (32%)
LRR_8 370..425 CDD:290566 16/55 (29%)
leucine-rich repeat 372..393 CDD:275380 4/21 (19%)
leucine-rich repeat 394..415 CDD:275380 9/21 (43%)
leucine-rich repeat 418..486 CDD:275380 16/70 (23%)
leucine-rich repeat 441..464 CDD:275378 3/23 (13%)
LRR_8 487..545 CDD:290566 17/58 (29%)
leucine-rich repeat 487..510 CDD:275380 6/23 (26%)
leucine-rich repeat 511..534 CDD:275380 8/23 (35%)
LRR_8 533..589 CDD:290566 11/56 (20%)
leucine-rich repeat 535..558 CDD:275380 6/23 (26%)
leucine-rich repeat 559..580 CDD:275380 4/21 (19%)
7tm_4 764..>892 CDD:304433 39/128 (30%)
7tm_1 770..1017 CDD:278431 81/269 (30%)
Rxfp1XP_006232570.1 LDLa 33..68 CDD:238060 4/23 (17%)
leucine-rich repeat 134..157 CDD:275380 5/47 (11%)
LRR_RI 138..356 CDD:238064 71/285 (25%)
LRR_8 158..216 CDD:290566 21/79 (27%)
leucine-rich repeat 158..181 CDD:275380 8/23 (35%)
leucine-rich repeat 182..205 CDD:275380 8/32 (25%)
LRR_8 205..265 CDD:290566 24/94 (26%)
leucine-rich repeat 206..229 CDD:275380 11/35 (31%)
leucine-rich repeat 230..254 CDD:275380 8/46 (17%)
leucine-rich repeat 255..278 CDD:275380 7/23 (30%)
LRR_8 278..337 CDD:290566 17/59 (29%)
leucine-rich repeat 279..302 CDD:275380 6/23 (26%)
leucine-rich repeat 303..326 CDD:275380 8/23 (35%)
leucine-rich repeat 327..350 CDD:275380 6/23 (26%)
leucine-rich repeat 351..371 CDD:275380 8/46 (17%)
7tm_1 427..686 CDD:278431 81/269 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.