DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rk and Lgr4

Sequence 1:NP_476702.1 Gene:rk FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_766259.2 Gene:Lgr4 MGIID:1891468 Length:951 Species:Mus musculus

Alignment Length:881 Identity:266/882 (30%)
Similarity:407/882 (46%) Gaps:107/882 (12%)


  Fly   152 CHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSII 216
            |.|.|.   .|:.|.|.|:.|||..|......||:..||:|:|..::|...|.||||.|:.|.:.
Mouse    33 CSCDGD---RRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLS 94

  Fly   217 NMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLR 281
            .:.|.|..||.:||.|:|||..||::|.::.:||:.|.||:|:.|.:.|:..|....|.:||.|.
Mouse    95 FIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLW 159

  Fly   282 LEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNL 346
            |:.|:...:|...|:.|.||:||.|..|.::.|.|..|..:.:|:||.|..|:|..:|......|
Mouse   160 LDDNILTEVPVRPLSNLPTLQALTLALNNISSIPDFAFTNLSSLVVLHLHNNKIKSLSQHCFDGL 224

  Fly   347 TALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWIND-----TELPRSMQMLDMRANPLST 406
            ..|:.|:|:.|.:...|:.:..|..|:||...||.:..|.|     ..|.|::.:.|   ||||.
Mouse   225 DNLETLDLNYNNLDEFPQAIKALPSLKELGFHSNSISVIPDGAFAGNPLLRTIHLYD---NPLSF 286

  Fly   407 ISPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELK 471
            :...||..:|.|..|::.....::.||.|.....||.|.|....|..:|.:||:....|::|:|.
Mouse   287 VGNSAFHNLSDLHSLVIRGASLVQWFPNLAGTVHLESLTLTGTKISSIPDDLCQNQKMLRTLDLS 351

  Fly   472 TNSLKRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQ 536
            .|.::.:|:                        |||.:.|.::.|..|:|..:.:..|||:..|:
Mouse   352 YNDIRDLPS------------------------FNGCRALEEISLQRNQISLIKETTFQGLTSLR 392

  Fly   537 LLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNNPKLREFPPPDTFP 601
            :|||..|.|..||..||:....:.:|::..|.....|..||..|..||...|.:|::......|.
Mouse   393 ILDLSRNLIREIHSGAFAKLGTITNLDVSFNELTSFPTEGLNGLNQLKLVGNFQLKDALAARDFA 457

  Fly   602 RIQTLILSYAYHCCAFLPLVAMSSQKKTSQVQEAVLFPSDAEFDMTLWNNSMMNIWPQMHNLSKQ 666
            .:::|.:.|||.||||                    :..|:..::...:||     ||.|:::|:
Mouse   458 NLRSLSVPYAYQCCAF--------------------WGCDSYANLNTEDNS-----PQDHSVTKE 497

  Fly   667 LGASMHDPWETAINFNEEQLQTQTGGQIATSYMEEYFEEHDVSGPATGYGFGTGLFSGMSTEDFQ 731
            .||                    |....|||..|.  |||...                      
Mouse   498 KGA--------------------TDAANATSTAES--EEHSQI---------------------- 518

  Fly   732 PGSVQCLPMPGPFLPCADLFDWWTLRCGVWVVFLLSLLGNGTVVFVLLCSRSKMDVPRFLVCNLA 796
              .:.|.|..|.|.||..|...|.:|..||.:||::||.|..|:..:..|.|.:...:..:..::
Mouse   519 --IIHCTPSTGAFKPCEYLLGSWMIRLTVWFIFLVALLFNLLVILTVFASCSSLPASKLFIGLIS 581

  Fly   797 AADFFMGIYLGILAIVDAATLGEFRMFAIPWQMSVLCQLSGFLAVLSSELSVYTLAVITLERNYA 861
            .::..||||.|||..:||.:.|.|..|.|.|:....|:::|.|||.|||.:|:.|.:..:||:..
Mouse   582 VSNLLMGIYTGILTFLDAVSWGRFAEFGIWWETGSGCKVAGSLAVFSSESAVFLLTLAAVERSVF 646

  Fly   862 ITHAIHLNKRLSLKQAGYIMSVGWVFALIMALMPLVGVSDYRKFAVCLPFETTTGPASLTYVISL 926
            ....:...|...|:|......|..:.|.|....||.....|....:||||.|...| ||.:.::|
Mouse   647 AKDVMKNGKSSHLRQFQVAALVALLGAAIAGCFPLFHGGQYSASPLCLPFPTGETP-SLGFTVTL 710

  Fly   927 MFINGCAFLTLMGCYLKMYWAIRGSQAWNTNDSRIAKRMALLVFTDFLCWSPIAFFSITAIFGLQ 991
            :.:|..|||.:...|.|:|..:........:.|.:.|.:|.|:||:.:.:.|:||||...:....
Mouse   711 VLLNSLAFLLMAIIYTKLYCNLEKEDPSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAI 775

  Fly   992 LISLEQAKIFTVFVLPLNSCCNPFLYAIMTKQFKKD 1027
            .||.|..|..|:...||.:|.||.||.....:||.|
Mouse   776 SISPEIMKSVTLIFFPLPACLNPVLYVFFNPKFKDD 811

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 8/21 (38%)
LRR_RI 180..>383 CDD:238064 73/203 (36%)
leucine-rich repeat 183..204 CDD:275380 8/21 (38%)
LRR_8 203..263 CDD:290566 27/60 (45%)
leucine-rich repeat 205..228 CDD:275380 10/23 (43%)
leucine-rich repeat 229..252 CDD:275380 11/23 (48%)
LRR_8 252..311 CDD:290566 22/59 (37%)
leucine-rich repeat 253..276 CDD:275380 8/23 (35%)
leucine-rich repeat 277..300 CDD:275380 8/23 (35%)
LRR_8 299..359 CDD:290566 21/60 (35%)
leucine-rich repeat 301..324 CDD:275380 8/23 (35%)
leucine-rich repeat 325..348 CDD:275380 8/23 (35%)
LRR_RI 327..567 CDD:238064 69/245 (28%)
leucine-rich repeat 349..371 CDD:275380 6/22 (27%)
LRR_8 370..425 CDD:290566 19/60 (32%)
leucine-rich repeat 372..393 CDD:275380 9/26 (35%)
leucine-rich repeat 394..415 CDD:275380 7/21 (33%)
leucine-rich repeat 418..486 CDD:275380 18/68 (26%)
leucine-rich repeat 441..464 CDD:275378 8/23 (35%)
LRR_8 487..545 CDD:290566 15/58 (26%)
leucine-rich repeat 487..510 CDD:275380 3/23 (13%)
leucine-rich repeat 511..534 CDD:275380 7/23 (30%)
LRR_8 533..589 CDD:290566 19/56 (34%)
leucine-rich repeat 535..558 CDD:275380 10/23 (43%)
leucine-rich repeat 559..580 CDD:275380 5/21 (24%)
7tm_4 764..>892 CDD:304433 40/128 (31%)
7tm_1 770..1017 CDD:278431 77/247 (31%)
Lgr4NP_766259.2 LRRNT 29..61 CDD:214470 11/31 (35%)
LRR 1 58..79 7/21 (33%)
leucine-rich repeat 59..82 CDD:275380 8/23 (35%)
LRR 2 82..103 8/21 (38%)
LRR_RI 83..375 CDD:238064 100/319 (31%)
LRR_8 83..141 CDD:290566 26/58 (45%)
leucine-rich repeat 83..106 CDD:275380 10/23 (43%)
LRR 3 106..127 9/21 (43%)
leucine-rich repeat 107..130 CDD:275380 11/23 (48%)
LRR 4 130..151 7/21 (33%)
leucine-rich repeat 131..154 CDD:275380 8/23 (35%)
LRR 5 154..177 8/23 (35%)
leucine-rich repeat 155..178 CDD:275380 8/23 (35%)
LRR_8 177..237 CDD:290566 21/60 (35%)
LRR 6 178..199 9/21 (43%)
leucine-rich repeat 179..202 CDD:275380 8/23 (35%)
LRR 7 202..223 7/21 (33%)
leucine-rich repeat 203..226 CDD:275380 8/23 (35%)
LRR 8 226..247 5/21 (24%)
leucine-rich repeat 227..249 CDD:275380 6/22 (27%)
LRR_8 248..305 CDD:290566 19/60 (32%)
LRR 9 249..270 7/21 (33%)
leucine-rich repeat 250..273 CDD:275380 7/23 (30%)
LRR_8 272..355 CDD:290566 27/86 (31%)
LRR 10 273..294 9/24 (38%)
leucine-rich repeat 274..295 CDD:275380 8/24 (33%)
LRR 11 320..341 8/21 (38%)
leucine-rich repeat 321..344 CDD:275380 8/23 (35%)
LRR 12 344..365 8/45 (18%)
leucine-rich repeat 345..366 CDD:275380 8/45 (18%)
LRR_8 365..425 CDD:290566 19/60 (32%)
LRR 13 366..387 6/21 (29%)
leucine-rich repeat 367..390 CDD:275380 7/23 (30%)
LRR 388..410 CDD:197688 10/22 (45%)
LRR 14 390..411 10/21 (48%)
leucine-rich repeat 391..414 CDD:275380 10/23 (43%)
LRR 15 414..435 5/21 (24%)
leucine-rich repeat 415..438 CDD:275380 6/23 (26%)
7tm_1 556..801 CDD:278431 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2087
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 383 1.000 Inparanoid score I2020
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D171884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T616066
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.920

Return to query results.
Submit another query.