DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rk and lgr5

Sequence 1:NP_476702.1 Gene:rk FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_002940219.2 Gene:lgr5 XenbaseID:XB-GENE-994091 Length:902 Species:Xenopus tropicalis

Alignment Length:901 Identity:256/902 (28%)
Similarity:413/902 (46%) Gaps:127/902 (14%)


  Fly   152 CHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSII 216
            |.|.....::|:.|....:.::|.||......|||..||:|.|.:|.......||||.|:.|.:.
 Frog    36 CECEQEGMLVRVDCSDRALTSLPRNLSIFTSYLDLSMNNITNLPSNVMHNLHFLEELRLAGNDLT 100

  Fly   217 NMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLR 281
            .:...||.||..||.|.|||..|:.:|.::...|..|.||:|:.|.:..:.......|..||.|.
 Frog   101 YIPKGAFAGLGSLKVLMLQNNLLRQVPSEALHNLRSLQSLRLDANHISYVPPSSFNGLFSLRHLW 165

  Fly   282 LEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNL 346
            |:.|....||..||..|..|:|:.|..|.:..|.|..|..:.:|:||.|..|:|..:.......|
 Frog   166 LDDNSLTEIPVRALESLSALQAMTLALNKIHHIPDYAFRNLSSLVVLHLHNNRIYSLGKKCFDGL 230

  Fly   347 TALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMR--ANPLSTISP 409
            .:|:.|:|:.|.:...|..:..|..|:||...||.::.|.:.....:..::.:.  .||:..:..
 Frog   231 HSLETLDLNYNNLDEFPAAIKTLKNLKELGFHSNNIKSIPEQAFIGNPSLITIHFYDNPIQHVGR 295

  Fly   410 GAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNS 474
            .||:.:.:||.|||:....:..||:|....:||.|.|..|.:..:|:.:|.|.|.|:.|:|..|.
 Frog   296 SAFQHLPELRTLILNGASQITEFPDLTGTTSLESLTLTGAQLVYLPSAVCTQLPNLQVLDLSYNH 360

  Fly   475 LKRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLD 539
            :|.:|:.|.|:.|:.:||..|::.:|:                        ...||.:..|:.||
 Frog   361 IKDLPSFSGCQRLQKIDLRHNEVYEIR------------------------STTFQQLVGLRSLD 401

  Fly   540 LEGNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNNPKLREFPPPDTFPRIQ 604
            |..|:|:.||..:||...:|..|:|.:|.....|.:||..|.|||...|..|::..|.:.||:::
 Frog   402 LAWNKIAVIHPNSFSSLPSLIKLDLSSNHLTSFPVTGLHGLTHLKLTGNSALQDLIPSEHFPKLR 466

  Fly   605 TLILSYAYHCCAFLPLVAMSSQKKTSQVQEAVLFPSDAEFDMTLWNNSMMNIWPQMHNLSKQLGA 669
            .:.:.|||.||||   ....:.|.:.|                               ::|...:
 Frog   467 VMEMPYAYQCCAF---AVCDNLKHSGQ-------------------------------MNKDENS 497

  Fly   670 SMHDPWETAINFNEEQLQTQTGGQIATSYMEEYFEEHDVSGPATGYGFGTGLFSGMSTEDFQP-- 732
            |..|                             |...|:           ||.......||:.  
 Frog   498 SADD-----------------------------FYRKDI-----------GLLHLQDDRDFEDFL 522

  Fly   733 ----------GSVQCLPMPGPFLPCADLFDWWTLRCGVWVVFLLSLLGNGTVVFVLLCSRSKMDV 787
                      .||||.|..|||.||..||..|..|.|||::.|||.:.|..|:..:....|.:..
 Frog   523 LDFEEDVKVLHSVQCTPSAGPFKPCDHLFGSWLTRTGVWLIVLLSFVCNALVIATVFRPLSYVPS 587

  Fly   788 PRFLVCNLAAADFFMGIYLGILAIVDAATLGEFRMFAIPWQMSVLCQLSGFLAVLSSELSVYTLA 852
            .:.|:..:|..:..||:..|:||.|||.|.|.|..:...|:..|.||::|||:|.::|.|::.|.
 Frog   588 IKLLIGLIAIMNTLMGLSSGVLATVDALTFGNFAQYGAWWESGVGCQITGFLSVFAAETSIFLLT 652

  Fly   853 VITLERNYAI-------THAIHLNKRLSLKQAGYIMSVGWVFALIMALMPLVGVSDYRKFAVCLP 910
            |..|||.::|       |.:..:|.:||:...       ::.::::|:.||:..|.|....:|.|
 Frog   653 VAALERGFSIKCTTKFETKSSFINVKLSIVFC-------FLLSIVIAVSPLLSGSTYGTSPLCFP 710

  Fly   911 FETTTGPASLTYVISLMFINGCAFLTLMGCYLKMYWAIRGSQAWNTNDSRIAKRMALLVFTDFLC 975
            . ....|:|:.::::|:.:|...||.:...|.|:|.::...:..|..|..:.|.:|||:||:.:.
 Frog   711 L-LFGDPSSMGFMVALVLLNSLCFLVMTIAYTKLYCSLEKGELENIWDCSMVKHIALLLFTNCIL 774

  Fly   976 WSPIAFFSITAIFGLQLISLEQAKIFTVFVLPLNSCCNPFLYAIMTKQFKKDCVTL 1031
            :.|:||.|.:::..|..||.|..|...:.::||.:|.||.||.:....||:|..:|
 Frog   775 YCPVAFLSFSSLLNLTFISPEVNKSILLLIIPLPACLNPLLYILFNPHFKEDIGSL 830

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 5/21 (24%)
LRR_RI 180..>383 CDD:238064 68/203 (33%)
leucine-rich repeat 183..204 CDD:275380 8/21 (38%)
LRR_8 203..263 CDD:290566 24/60 (40%)
leucine-rich repeat 205..228 CDD:275380 10/23 (43%)
leucine-rich repeat 229..252 CDD:275380 9/23 (39%)
LRR_8 252..311 CDD:290566 20/59 (34%)
leucine-rich repeat 253..276 CDD:275380 6/23 (26%)
leucine-rich repeat 277..300 CDD:275380 10/23 (43%)
LRR_8 299..359 CDD:290566 18/60 (30%)
leucine-rich repeat 301..324 CDD:275380 7/23 (30%)
leucine-rich repeat 325..348 CDD:275380 7/23 (30%)
LRR_RI 327..567 CDD:238064 67/242 (28%)
leucine-rich repeat 349..371 CDD:275380 6/22 (27%)
LRR_8 370..425 CDD:290566 15/57 (26%)
leucine-rich repeat 372..393 CDD:275380 6/21 (29%)
leucine-rich repeat 394..415 CDD:275380 4/23 (17%)
leucine-rich repeat 418..486 CDD:275380 25/68 (37%)
leucine-rich repeat 441..464 CDD:275378 9/23 (39%)
LRR_8 487..545 CDD:290566 12/58 (21%)
leucine-rich repeat 487..510 CDD:275380 5/23 (22%)
leucine-rich repeat 511..534 CDD:275380 2/23 (9%)
LRR_8 533..589 CDD:290566 22/56 (39%)
leucine-rich repeat 535..558 CDD:275380 10/23 (43%)
leucine-rich repeat 559..580 CDD:275380 7/21 (33%)
7tm_4 764..>892 CDD:304433 39/135 (29%)
7tm_1 770..1017 CDD:278431 75/254 (30%)
lgr5XP_002940219.2 LRRNT 32..>61 CDD:214470 6/25 (24%)
LRR_RI <52..195 CDD:238064 50/143 (35%)
leucine-rich repeat 65..88 CDD:275380 8/23 (35%)
LRR_8 89..147 CDD:290566 24/58 (41%)
leucine-rich repeat 89..112 CDD:275380 10/23 (43%)
leucine-rich repeat 113..136 CDD:275380 9/23 (39%)
LRR_8 135..195 CDD:290566 20/60 (33%)
leucine-rich repeat 137..160 CDD:275380 6/23 (26%)
LRR_RI 160..383 CDD:238064 69/223 (31%)
leucine-rich repeat 161..184 CDD:275380 10/23 (43%)
LRR_8 185..243 CDD:290566 18/58 (31%)
leucine-rich repeat 185..208 CDD:275380 7/23 (30%)
leucine-rich repeat 209..232 CDD:275380 7/23 (30%)
leucine-rich repeat 233..255 CDD:275380 6/22 (27%)
LRR_8 254..311 CDD:290566 15/57 (26%)
leucine-rich repeat 256..279 CDD:275380 6/23 (26%)
leucine-rich repeat 280..301 CDD:275380 4/21 (19%)
AMN1 318..469 CDD:187754 53/175 (30%)
LRR_8 325..381 CDD:290566 20/56 (36%)
leucine-rich repeat 327..350 CDD:275378 9/23 (39%)
leucine-rich repeat 351..372 CDD:275378 8/21 (38%)
LRR_8 372..431 CDD:290566 21/83 (25%)
leucine-rich repeat 373..396 CDD:275378 7/47 (15%)
leucine-rich repeat 397..420 CDD:275378 10/23 (43%)
leucine-rich repeat 421..433 CDD:275378 4/12 (33%)
7tm_4 562..>692 CDD:304433 39/137 (28%)
7tm_1 571..816 CDD:278431 75/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H20807
Inparanoid 1 1.050 385 1.000 Inparanoid score I1872
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D171884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.