DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and dcn

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001093704.1 Gene:dcn / 100101716 XenbaseID:XB-GENE-485545 Length:364 Species:Xenopus tropicalis


Alignment Length:422 Identity:98/422 - (23%)
Similarity:160/422 - (37%) Gaps:129/422 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 CHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSII 216
            |.|  .|.|::  |..||:..||.::|::..:|||.||.:|:::...|....||..|.|.:|.|.
 Frog    63 CQC--HLRVVQ--CSDIGLEQVPKDIPSDTTLLDLQNNKITEIKEGDFKNLKNLHALILVNNKIK 123

  Fly   217 NMDPNAFYGLAKLKRLSLQNCGLKSLP---PQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLR 278
            ::.|:||..|.||:||.|....||.||   |:|                              |:
 Frog   124 SISPSAFASLTKLERLYLSKNNLKDLPANMPKS------------------------------LQ 158

  Fly   279 TLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGAL 343
            .||:..|...::..:...||..:..:.||:|.:                      :...:..||.
 Frog   159 ELRVHENSITKLKKSVFDGLNNMIVVELGTNPI----------------------ESSGVEKGAF 201

  Fly   344 KNLTALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLSTIS 408
            :.:..|..|.:.|..|:|:|:|                        ||.|:..|.:..|.::.:.
 Frog   202 QGMKKLSYLRIADTNITSIPKG------------------------LPASLTELHLDGNKIAKVD 242

  Fly   409 PGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTN 473
            ..:..|::.|.||.||               ...|:.|:...:..|        |.|:.|.|..|
 Frog   243 SDSLNGLNNLAKLGLS---------------YNNIITLENGTVTGV--------PHLRELHLDHN 284

  Fly   474 SLKRIP-NLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLL-LSYNRIKALPQDAFQGIPKLQ 536
            ||.::| .|...:.::::.|.:|:|..:         ..||.. |.||..||    ::.||    
 Frog   285 SLTQVPAGLGEHKYIQVVYLHNNKISAV---------STNDFCPLGYNTKKA----SYSGI---- 332

  Fly   537 LLDLEGNEISY--IHKEAFSGFTALEDLNLGN 566
              .|..|.:.|  |....|........:.:||
 Frog   333 --SLFSNPVQYWEIQPATFRCVYERSAIQIGN 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 7/20 (35%)
LRR_RI 180..>383 CDD:238064 46/205 (22%)
leucine-rich repeat 183..204 CDD:275380 7/20 (35%)
LRR_8 203..263 CDD:290566 21/62 (34%)
leucine-rich repeat 205..228 CDD:275380 9/22 (41%)
leucine-rich repeat 229..252 CDD:275380 10/25 (40%)
LRR_8 252..311 CDD:290566 9/58 (16%)
leucine-rich repeat 253..276 CDD:275380 0/22 (0%)
leucine-rich repeat 277..300 CDD:275380 6/22 (27%)
LRR_8 299..359 CDD:290566 8/59 (14%)
leucine-rich repeat 301..324 CDD:275380 3/22 (14%)
leucine-rich repeat 325..348 CDD:275380 2/22 (9%)
LRR_RI 327..567 CDD:238064 51/244 (21%)
leucine-rich repeat 349..371 CDD:275380 7/21 (33%)
LRR_8 370..425 CDD:290566 10/54 (19%)
leucine-rich repeat 372..393 CDD:275380 2/20 (10%)
leucine-rich repeat 394..415 CDD:275380 2/20 (10%)
leucine-rich repeat 418..486 CDD:275380 17/68 (25%)
leucine-rich repeat 441..464 CDD:275378 3/22 (14%)
LRR_8 487..545 CDD:290566 14/58 (24%)
leucine-rich repeat 487..510 CDD:275380 3/22 (14%)
leucine-rich repeat 511..534 CDD:275380 9/23 (39%)
LRR_8 533..589 CDD:290566 7/36 (19%)
leucine-rich repeat 535..558 CDD:275380 5/24 (21%)
leucine-rich repeat 559..580 CDD:275380 2/8 (25%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
dcnNP_001093704.1 LRRNT 58..90 CDD:214470 10/30 (33%)
leucine-rich repeat 67..87 CDD:275380 8/21 (38%)
PRK15370 <75..>303 CDD:185268 74/326 (23%)
leucine-rich repeat 88..111 CDD:275380 7/22 (32%)
leucine-rich repeat 112..135 CDD:275380 9/22 (41%)
leucine-rich repeat 136..156 CDD:275380 9/19 (47%)
leucine-rich repeat 157..180 CDD:275380 6/22 (27%)
leucine-rich repeat 181..206 CDD:275380 5/46 (11%)
leucine-rich repeat 207..227 CDD:275380 9/43 (21%)
leucine-rich repeat 228..251 CDD:275380 3/22 (14%)
leucine-rich repeat 252..275 CDD:275380 8/45 (18%)
leucine-rich repeat 299..320 CDD:275380 5/29 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.