DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimC1 and NimC3

Sequence 1:NP_001260453.1 Gene:NimC1 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_524928.2 Gene:NimC3 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster

Alignment Length:198 Identity:55/199 (28%)
Similarity:80/199 (40%) Gaps:44/199 (22%)


  Fly     7 SLHFVCLSLSFGTSFAILRHGLNDCSHPESVPYNRKVLKSKLV---------PFQQYSYFHGWVT 62
            ::|.|.:|     |.||..   ..|....||.|...|.|:::.         |....||      
  Fly    16 TIHLVEVS-----SLAITN---GHCQKNISVKYQVPVAKTRMAGAGPPNASHPIDLDSY------ 66

  Fly    63 KYRHQYVYEDETAYRTVMRPSCCEGYEGSVEN-CKPVCRQQCPQHGFCSSPNTCSCNAGY----- 121
                 .|||:...:..:.  .||.||...:.. |:|||::.||.|.:|:.|:.|.|..||     
  Fly    67 -----VVYEERVRWDNIQ--VCCPGYRTILFGFCEPVCQEACPAHSYCAEPDRCHCQRGYEPSHH 124

  Fly   122 ----GGIDCHPVCPTVCGKNEFCDRPGVCSCQNGYKRTSPSDNCLPVCEK-ECGHHS-FCSEPGK 180
                ..:.|.|||...|.::..|.....|.|..|:|..|...:....||: :|||.. |  :||:
  Fly   125 HTTGHQLICRPVCQGGCPEHSHCVAHNECECWPGFKDASSWFSLSLRCERVQCGHEQRF--DPGR 187

  Fly   181 CEC 183
            ..|
  Fly   188 RAC 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
NimC3NP_524928.2 MSC 85..>212 CDD:286487 34/109 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24047
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.