DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimB4 and Pear1

Sequence 1:NP_788046.1 Gene:NimB4 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001027585.1 Gene:Pear1 MGIID:1920432 Length:1034 Species:Mus musculus

Alignment Length:391 Identity:108/392 (28%)
Similarity:142/392 (36%) Gaps:119/392 (30%)


  Fly    65 SSSTTTRKPYIIPNGL----SLPRRGEHPDKCRQEVPAVFFQ--YDKEVKIVGNSSTNPYMNVIE 123
            |.:|||::.::.|..|    |..|..|.|..|.|  |.|.::  |.:.||:    .:.|.:.   
Mouse    32 SFTTTTKESHLRPFSLLPAESCHRPWEDPHTCAQ--PTVVYRTVYRQVVKM----DSRPRLQ--- 87

  Fly   124 VCCKGWRRYEYDWSQCVPDCGERCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYL 188
             ||:|:  ||                                   .|..|||.|...|.||||..
Mouse    88 -CCRGY--YE-----------------------------------SRGACVPLCAQECVHGRCVA 114

  Fly   189 NGTCQCDKGYELDGSRKFCQ-----PQCN--ATCGHNEVCLEP--GKCSCAEGY--TRGLRESAA 242
            ...|||..|:........|.     |||:  ..||:|..| :|  |.|.|..|.  ...|:...|
Mouse   115 PNQCQCAPGWRGGDCSSECAPGMWGPQCDKFCHCGNNSSC-DPKSGTCFCPSGLQPPNCLQPCPA 178

  Fly   243 LGCQPICIPDCG-YGHCVRPNE--CECFPGFQKRKNGITCEGDCYMTCENGFCANKTTCVCQNGY 304
            ....|.|..||. ||....|.:  |.|.||    :.|.:|...|....:..||..  |..||||.
Mouse   179 GHYGPACQFDCQCYGASCDPQDGACFCPPG----RAGPSCNVPCSQGTDGFFCPR--TYPCQNGG 237

  Fly   305 RYDKNTTTCL--------------------PDCGDNC---DNGVCIS-PGNCRCFKGYVRNRERC 345
            ....:..:|.                    |:|...|   :.|:|.. .|.|.|..||:  .:||
Mouse   238 VPQGSQGSCSCPPGWMGVICSLPCPEGFHGPNCTQECRCHNGGLCDRFTGQCHCAPGYI--GDRC 300

  Fly   346 EAVCVGGCGFYGKCIAPNVCGCAIVPGPERTYQRCEYGLCNAMGRCRCQVGMTRFIDRC---MSP 407
            :..|  ..|.:|:..| ..|.||  ||     .||    ..|.|.|.|:.|.|.  |||   :.|
Mouse   301 QEEC--PVGRFGQDCA-ETCDCA--PG-----ARC----FPANGACLCEHGFTG--DRCTERLCP 349

  Fly   408 D 408
            |
Mouse   350 D 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Pear1NP_001027585.1 EMI 25..93 CDD:284877 21/73 (29%)
EGF_CA 535..580 CDD:304395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.