DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimB4 and eater

Sequence 1:NP_788046.1 Gene:NimB4 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_651533.3 Gene:eater FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster

Alignment Length:382 Identity:125/383 (33%)
Similarity:161/383 (42%) Gaps:79/383 (21%)


  Fly    89 PDKCRQEVPAVFFQYDKEV-----KIVGNSSTNPYMNVIEVC-CKGWRRYEYDW-SQCVPDCGER 146
            |:||..:.     .|.||.     .|..|...|.:.:..|.| |..  .||.|. ::|.|.|...
  Fly   541 PEKCSCDE-----GYSKETGNSCKPICSNGCENGFCDAPEKCSCND--GYEMDGENRCSPVCSGG 598

  Fly   147 CQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKGYELDGSRKFCQPQC 211
            | :||||||.|||.|...:.....|:|.|.|..||.:|.|.....|.|:.|||:|...: |.|.|
  Fly   599 C-KNGFCVAPGKCSCDEGYSKETGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDSENR-CSPVC 661

  Fly   212 NATCGHNEVCLEPGKCSCAEGYTR-----------------------------GLRESAALGCQP 247
            :..| .|..|:.||||||.|||::                             |....:...|.|
  Fly   662 SGGC-KNGFCIAPGKCSCDEGYSKETGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDSENRCSP 725

  Fly   248 ICIPDCGYGHCVRPNECECFPGFQKRKNGITCEGDCYMTCENGFCANKTTCVCQNGYRYDKNTTT 312
            :|...|..|.||.|.:|.|..|:.| :.|.:|:..|...||||||.....|.|.:||..| ....
  Fly   726 VCSGGCKNGFCVAPGKCSCDEGYSK-ETGNSCKPICSKGCENGFCEAPEKCSCNDGYEMD-GENR 788

  Fly   313 CLPDCGDNCDNGVCISPGNCRCFKGYVRNR-ERCEAVCVGGC--GFYGKCIAPNVCGCAIVPGPE 374
            |.|.|...|.||.||:||.|.|.:||.|.. ..|:.:|..||  ||   |.||..|.|.  .|.|
  Fly   789 CSPVCSGGCKNGFCIAPGKCSCDEGYSRETGNSCKPICSKGCENGF---CDAPEKCSCN--DGYE 848

  Fly   375 RTYQR---------CEYGLCNAMGRCRCQVGMTRFID--------------RCMSPD 408
            ...:.         |:.|.|.|.|:|.|..|.::..:              .|:|||
  Fly   849 MDSENRCSPVCSGGCKNGFCVAPGKCSCDEGYSKETEISCAPFCKDGCVNGLCVSPD 905



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24047
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.