DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimB4 and drpr

Sequence 1:NP_788046.1 Gene:NimB4 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster

Alignment Length:469 Identity:117/470 (25%)
Similarity:168/470 (36%) Gaps:144/470 (31%)


  Fly    15 LVLFLCVLHGLELQLHEQQLQQQKDEQLRLRAEQRQRELL-REHEALQRRLSSSTTTRKPYIIPN 78
            ::|..|:   .:|.|.:..|:......:..|.|....::: .|.::.|.|.|:...|        
  Fly     4 VILIACL---AQLVLAQADLKDLDGPNICKRRELYNVDVVYTELQSFQERGSTWCVT-------- 57

  Fly    79 GLSLPRRGEHPDKCRQEVPAVFFQYDKEVKIVGNSSTNPYMNVIEVCCKGWRRYEYDWSQCVPDC 143
                     .|.:|.        .|..:.::|..:.|.....::..||.|   |.....:|||.|
  Fly    58 ---------FPPRCS--------TYRIKHRVVNKTKTIAKNRIVRDCCDG---YIASAGECVPHC 102

  Fly   144 GERCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKGYELDGSRKFCQ 208
            .|.|| :|.|::..||.|...:       ..|.|.:.||.|....|.:.|||             
  Fly   103 SEPCQ-HGRCISPEKCKCDHGY-------GGPACDINCPPGWYGRNCSMQCD------------- 146

  Fly   209 PQCNATCGHNEVCLEP--GKCSCAEGYTRGLRESAALGCQPICIPDCGYG-HCVR---------- 260
                  |.:|.|| ||  |.|.||:||| |.|      |..|| |:..:| :|..          
  Fly   147 ------CLNNAVC-EPFSGDCECAKGYT-GAR------CADIC-PEGFFGANCSEKCRCENGGKC 196

  Fly   261 ---PNECECFPGF---------QKRKNGITCEGDCYMTCEN-GFCANKT-TCVCQNGYRYDKNTT 311
               ..||:|.|||         ...|:|..|:.||  .|:| |.|..:| .|:|..|:..|....
  Fly   197 HHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQDC--PCQNDGKCQPETGACMCNPGWTGDVCAN 259

  Fly   312 TCL-----PDCGDNCDNGVCIS-------PGNCRCFKGYVRNR--ERCEAVCVG-GCGFYGKCIA 361
            .|.     |.|.::|:   |..       .|.|.|..||...|  :.|:....| .|.....|..
  Fly   260 KCPVGSYGPGCQESCE---CYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCAN 321

  Fly   362 PNVCG-----CAIVPG------PERTYQRCEYGL-CN---------------AMGRCRCQVGMTR 399
            ..:|.     |...||      .||..:..:||| ||               ..|.|:|.:|.:.
  Fly   322 DAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSS 386

  Fly   400 FIDRCMSPDTVTTY 413
              .:|..|.|...|
  Fly   387 --AQCTRPCTFLRY 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
drprNP_001261276.1 EMI 27..92 CDD:284877 16/93 (17%)
EGF_CA 274..319 CDD:304395 11/48 (23%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.