DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimB4 and dsl-7

Sequence 1:NP_788046.1 Gene:NimB4 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001023803.1 Gene:dsl-7 WormBaseID:WBGene00001109 Length:313 Species:Caenorhabditis elegans

Alignment Length:222 Identity:44/223 (20%)
Similarity:56/223 (25%) Gaps:119/223 (53%)


  Fly    69 TTRKPYIIPNGLSLPRRGEHPD-KCRQEVPAVFFQYDKEVKIVGNSSTNPYMNVIEVCCKGWRRY 132
            :|||..|:|....||..|...| ||                     .|| |...           
 Worm    97 STRKMSIVPPKAGLPFSGFRIDIKC---------------------DTN-YFGA----------- 128

  Fly   133 EYDWSQCVPDCGERCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKG 197
                     .|...|.|......|.:|        |...|      :|||.|   :.|: :||  
 Worm   129 ---------HCEHFCDEEQARSMGRRC--------NILGN------IGCPIG---VRGS-KCD-- 164

  Fly   198 YELDGSRKFCQPQCNATCGHNEVCLEPGKCSCAEGYTRGLRESAALGCQPICIPDCGYGHCVRPN 262
                                .|:.::.|.|.|..|                       |.||...
 Worm   165 --------------------IELPIDSGICKCMNG-----------------------GKCVNSF 186

  Fly   263 E---------CECFPGFQKRKNGITCE 280
            :         |||..||:    |..||
 Worm   187 DSKLTADFPICECLNGFE----GAACE 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
dsl-7NP_001023803.1 DSL 101..163 CDD:128366 23/122 (19%)
EGF_CA <176..209 CDD:238011 12/60 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.