DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimB4 and NimB1

Sequence 1:NP_788046.1 Gene:NimB4 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001260452.1 Gene:NimB1 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster

Alignment Length:364 Identity:174/365 (48%)
Similarity:230/365 (63%) Gaps:25/365 (7%)


  Fly    85 RGEHPDKCRQEVPAVFFQYDKEVKIVGNSSTNPYMNVIEVCCKGWRRYEYDWSQCVPDCG----E 145
            |.:|  .|.:|||:||||.:::..:.||.|| .|.:.|||||.|:||..|. ::|||||.    :
  Fly    54 RQQH--LCHREVPSVFFQTERDSPVRGNGST-IYFHRIEVCCAGYRRDPYA-NECVPDCSASSPD 114

  Fly   146 RCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKGYELD-GSRKFCQP 209
            .|: ||||.:.|.|.||.:||.|....|:.|||:.|.||||||||||.|.:.:.|| .:|:||:|
  Fly   115 NCR-NGFCRSPGVCECFAEFVRNEHGACIHTCPIACQHGRCYLNGTCVCHQNFVLDQETRQFCRP 178

  Fly   210 QCNATCGHNEVCLEPGKCSCAEGYTRGLRESAALGCQPICIPDCGYGHCVRPNECECFPGFQKRK 274
            :|:.:||.:|.|:.||:|.|:.||    |.:..|||||:|.||||:|.||.||:||||.||.||.
  Fly   179 KCSQSCGTHEECVAPGQCDCSPGY----RRTPDLGCQPVCAPDCGFGKCVAPNQCECFAGFIKRP 239

  Fly   275 NGITCEGDCYMTCENGFCANKTTCVCQNGYRYDKNTTTCLPDCGDNC--DNGVCISPGNCRCFKG 337
            |...||.:||:.||||.|.::..|.|:.|||||.|||:|||:|.|||  .|||||:||.||||:|
  Fly   240 NWNVCEAECYLNCENGLCESRYKCHCREGYRYDVNTTSCLPECSDNCGQGNGVCIAPGVCRCFRG 304

  Fly   338 YVRNRERCEAVCVGG-CGFYGKCIAPNVCGCAIVPGPERTYQRCEYGLCNAMGRCRCQVGMTRFI 401
            |..:...|...|... ||.||:|:||.:|||.      ...|.|..|.|:.:..|.|..|.|.||
  Fly   305 YEVHGAECRPKCESRFCGKYGRCVAPEICGCG------EGQQHCRNGSCDDIEHCSCPSGETHFI 363

  Fly   402 DRCMSPDTVTTYASMNPVK--VNASLIQEFNLLLGRHFN 438
            |||:..|.::.:.:.:..:  .|..|..|||.|:||.||
  Fly   364 DRCLKADRLSQHLNTSEKRKHFNRQLAYEFNALIGRLFN 402



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131109888
eggNOG 1 0.900 E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5078
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24047
RoundUp 00.000 Not matched by this tool.
43.980

Return to query results.
Submit another query.