DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimB4 and NimA

Sequence 1:NP_788046.1 Gene:NimB4 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001285918.1 Gene:NimA FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster

Alignment Length:240 Identity:58/241 (24%)
Similarity:81/241 (34%) Gaps:92/241 (38%)


  Fly   221 CLE-PGKCS-----------------------CAEGYTRGLRESAALGCQPICIPDCGYGHCVRP 261
            |:| |.:|:                       |.:||...|.:|.|. |:|||...||.|.||.|
  Fly    80 CMEIPPRCATFKTEMREVMRVQKLNKTRTVRFCCQGYEGNLSDSQAT-CKPICRGGCGRGSCVMP 143

  Fly   262 NECECFPGFQKRKNGITCEGDCY-MTCENGFCANKTTCVCQNGYRYDKNTTTCLPDCGDNCDNGV 325
            :.|.|..|:..:.....|:.|.: :.|:|       .|.||||..               |||  
  Fly   144 DICSCEEGYIGKHCTQRCDHDRWGLDCKN-------LCQCQNGAA---------------CDN-- 184

  Fly   326 CISPGNCRCFKGYVRNRERCEAVCVGGCGFYGKCIAPNVCGCAIVPGPERTYQRCEYGLCNAMGR 390
              ..|.|.|..|:  ..:.||..|..|.  || .:....|.|...|                   
  Fly   185 --KSGLCHCIAGW--TGQFCELPCPQGT--YG-IMCRKACDCDEKP------------------- 223

  Fly   391 CRCQVGMTRFIDRCMSPDTVTTYASMNPVKVNAS--LIQEFNLLL 433
            |..|.|      .|:..|        .|:::|.|  :::..|..|
  Fly   224 CNPQTG------ACIQQD--------QPLQLNVSHVIVETVNSTL 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
NimANP_001285918.1 EMI 52..116 CDD:284877 6/36 (17%)
EGF_2 170..200 CDD:285248 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.