DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimB4 and Y64G10A.7

Sequence 1:NP_788046.1 Gene:NimB4 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001255802.1 Gene:Y64G10A.7 WormBaseID:WBGene00013416 Length:1714 Species:Caenorhabditis elegans

Alignment Length:388 Identity:101/389 (26%)
Similarity:132/389 (34%) Gaps:143/389 (37%)


  Fly   125 CCKGWRRYEYDWSQCVPDC-----GERCQE-------------NGFCVA-----GGKC--VCFTD 164
            |..||     ....|...|     |.:|:|             :|.|..     |.||  .|...
 Worm  1251 CLPGW-----SGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKG 1310

  Fly   165 FVLNYRNNCVPTCPLGCPHGRC-------YLNGTCQCDKGY------EL--DGS-RKFCQPQCNA 213
            :   :..:|..:|       ||       :::|.|||.|||      ||  ||: .:.|..:|: 
 Worm  1311 Y---FGRHCSQSC-------RCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCD- 1364

  Fly   214 TCGHNEVC-LEPGKCSCAEGYTRGLRESAALGCQPICI-----PDCGY-------GHC-VRPNEC 264
             ||.|.:| ...|||.|..|:       :...|:..|:     |||..       |.| .....|
 Worm  1365 -CGENSMCDAISGKCFCKPGH-------SGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSC 1421

  Fly   265 ECFPGF---------QKRKNGITCEGDCYMTCENGFCANKTT--CVCQNGYRYDKNTTTCLPDCG 318
            .|.||:         |..:.|.|||..|  .||||...::.|  |.|..|:    ...||...|.
 Worm  1422 VCPPGYIGTKCEIACQSDRFGPTCEKIC--NCENGGTCDRLTGQCRCLPGF----TGMTCNQVCP 1480

  Fly   319 D-----------NCDNGVC-ISPGNCRCFKGYVRNRERCEAVCVGG---------CGFYGKCIAP 362
            :           .|.||.| .|.|.|:|..|:  ....||..|..|         |..||:....
 Worm  1481 EGRFGAGCKEKCRCANGHCNASSGECKCNLGF--TGPSCEQSCPSGKYGLNCTLDCECYGQARCD 1543

  Fly   363 NVCGCAIVPGPERTYQRCEYGLCN---------------------AMGRCRCQVGMTRFIDRC 404
            .|.||...| |.|...||::...|                     |.|||.|..|...  |:|
 Worm  1544 PVQGCCDCP-PGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQG--DKC 1603

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Y64G10A.7NP_001255802.1 EMI 35..105 CDD:284877
FXa_inhibition 159..194 CDD:291342
FXa_inhibition 200..235 CDD:291342
FXa_inhibition 241..278 CDD:291342
vWFA <319..358 CDD:294047
FXa_inhibition 366..402 CDD:291342
vWFA <460..502 CDD:294047
FXa_inhibition 509..544 CDD:291342
FXa_inhibition 550..585 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.